CEACAM6;NCA

Carcinoembryonic antigen-related cell adhesion molecule 6 (Non-specific crossreacting antigen) (Normal cross-reacting antigen) (CD antigen CD66c)

Homo sapiens (Human)

37195

344

Pending Verification

Carcinoembryonic antigen-related cell adhesion molecule 6 (Non-specific crossreacting antigen) (Normal cross-reacting antigen) (CD antigen CD66c)

N/A

MUTAGEN 38 38 I->A: Loss of homodimerization and heterodimerization with CEACAM8. {ECO:0000269|PubMed:26483485}.; MUTAGEN 53 53 L->A: No effect on homodimerization. Reduces heterodimerization with CEACAM8. {ECO:0000269|PubMed:26483485}.; MUTAGEN 55 55 A->V: No effect on homophilic and heterophilic cell adhesion. {ECO:0000269|PubMed:11590190}.; MUTAGEN 61 61 N->H: Inhibits homophilic and heterophilic cell adhesion. {ECO:0000269|PubMed:11590190}.; MUTAGEN 62 62 R->L: No effect on homophilic cell adhesion. Reduces heterophilic cell adhesion. {ECO:0000269|PubMed:11590190}.; MUTAGEN 63 63 I->F: No effect on homophilic cell adhesion. Inhibits heterophilic cell adhesion. {ECO:0000269|PubMed:11590190}.; MUTAGEN 66 66 S->N: Inhibits homophilic cell adhesion. Reduces heterophilic cell adhesion. {ECO:0000269|PubMed:11590190}.; MUTAGEN 78 78 L->Q: Inhibits homophilic cell adhesion. No effect on heterophilic cell adhesion. {ECO:0000269|PubMed:11590190}.; MUTAGEN 123 123 Q->A: No effect on homodimerization. Reduces heterodimerization with CEACAM8. {ECO:0000269|PubMed:26483485}.; MUTAGEN 129 129 L->A: Reduces homodimerization. Loss of heterodimerization with CEACAM8. {ECO:0000269|PubMed:26483485}.

MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI

Cell surface glycoprotein that plays a role in cell adhesion and tumor progression (PubMed:2803308, PubMed:2022629, PubMed:1378450, PubMed:8776764, PubMed:11590190, PubMed:10910050, PubMed:14724575, PubMed:16204051). Intercellular adhesion occurs in a calcium- and fibronectin-independent manner (PubMed:2022629, PubMed:16204051). Mediates homophilic and heterophilic cell adhesion with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM5 and CEACAM8 (PubMed:2803308, PubMed:2022629, PubMed:8776764, PubMed:11590190, PubMed:16204051). Heterophilic interaction with CEACAM8 occurs in activated neutrophils (PubMed:8776764). Plays a role in neutrophil adhesion to cytokine-activated endothelial cells (PubMed:1378450). Plays a role as an oncogene by promoting tumor progression; positively regulates cell migration, cell adhesion to endothelial cells and cell invasion (PubMed:16204051). Also involved in the metastatic cascade process by inducing gain resistance to anoikis of pancreatic adenocarcinoma and colorectal carcinoma cells (PubMed:10910050, PubMed:14724575). {ECO:0000269|PubMed:10910050, ECO:0000269|PubMed:11590190, ECO:0000269|PubMed:1378450, ECO:0000269|PubMed:14724575, ECO:0000269|PubMed:16204051, ECO:0000269|PubMed:2022629, ECO:0000269|PubMed:2803308, ECO:0000269|PubMed:8776764}.

Beta strand (9); Chain (1); Disulfide bond (2); Domain (3); Glycosylation (12); Helix (2); Lipidation (1); Mutagenesis (10); Natural variant (1); Propeptide (1); Sequence conflict (1); Signal peptide (1); Turn (1); Up-regulated in anoikis-resistant pancreatic adenocarcinoma cells (at protein level). {ECO:0000269|PubMed:14724575}.; Expressed in neutrophils (PubMed:1378450). Expressed in columnar epithelial and goblet cells of the colon (PubMed:10436421). Expressed in numerous tumor cell lines (at protein level) (PubMed:16204051). {ECO:0000269|PubMed:10436421, ECO:0000269|PubMed:1378450, ECO:0000269|PubMed:16204051}.

Carcinoembryonic antigen-related cell adhesion molecule 6 (Non-specific crossreacting antigen) (Normal cross-reacting antigen) (CD antigen CD66c)

Recombinant

HEK293

Lyophilized

7.4-7.5

Sterile-filtered colorless solution

1mg/ml

Standard

PBS

SDS-PAGE

> 98%

RP-HPLC

-20°C

This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.

Reconstitute in sterile distilled H2O to no less than 100ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.