PLA2G1B
Human Recombinant PLA2G1B - His Tagged
Reference ID:KB-3960
Migration assay
Gene of Interest
Gene Synonyms:PLA2G1B;PLA2;PLA2A;PPLA2
Protein Names:Phospholipase A2 (EC 3.1.1.4) (Group IB phospholipase A2) (Phosphatidylcholine 2-acylhydrolase 1B)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):163.60
Length (aa):148
Sequence:MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 12
Active Site:ACT_SITE 70 70 {ECO:0000250}.; ACT_SITE 121 121 {ECO:0000250}.
Catalytic Activity: Reaction=a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+); Xref=Rhea:RHEA:15801, ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:28868, ChEBI:CHEBI:57643, ChEBI:CHEBI:58168; EC=3.1.1.4; Evidence={ECO:0000255|PROSITE-ProRule:PRU10035, ECO:0000255|PROSITE-ProRule:PRU10036};
Cofactor:Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={ECO:0000250}; Note=Binds 1 Ca(2+) ion per subunit. {ECO:0000250};
Function [CC]:PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides, this releases glycerophospholipids and arachidonic acid that serve as the precursors of signal molecules. {ECO:0000269|PubMed:19297324}.
Metal Binding:METAL 50 50 Calcium; via carbonyl oxygen. {ECO:0000250}.; METAL 52 52 Calcium; via carbonyl oxygen. {ECO:0000250}.; METAL 54 54 Calcium; via carbonyl oxygen. {ECO:0000250}.; METAL 71 71 Calcium. {ECO:0000250}.
Chemical Profile | ChEBI:H2O [CHEBI:15377]; H(+) [CHEBI:15378]; a fatty acid [CHEBI:28868]; Ca(2+) [CHEBI:29108]; a 1-acyl-sn-glycero-3-phosphocholine [CHEBI:58168]; a 1,2-diacyl-sn-glycero-3-phosphocholine [CHEBI:57643]
ChEBI (Catalytic Activity):H2O [CHEBI:15377]; H(+) [CHEBI:15378]; a fatty acid [CHEBI:28868]; a 1-acyl-sn-glycero-3-phosphocholine [CHEBI:58168]; a 1,2-diacyl-sn-glycero-3-phosphocholine [CHEBI:57643]
ChEBI (Cofactor):Ca(2+) [CHEBI:29108]
Reagent Data
Name:PLA2G1B
Subcategory:Protein
Region:Ala 23 - Ser 148
Molecular Weight:15
Source:HEK293
Species:Human
Tag:His
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.