Arginase 1
Human Recombinant ARG1 - His Tagged
Reference ID:KB-3940
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:ARG1
Protein Names:Arginase-1 (EC 3.5.3.1) (Liver-type arginase) (Type I arginase)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):347.35
Length (aa):322
Sequence:MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Pathway:Nitrogen metabolism; urea cycle; L-ornithine and urea from L-arginine: step 1/1. {ECO:0000305|PubMed:16141327}.
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 6
Binding Site:BINDING 183 183 Substrate. {ECO:0000244|PDB:3GMZ, ECO:0000244|PDB:3GN0, ECO:0000244|PDB:3KV2, ECO:0000244|PDB:3LP7, ECO:0000244|PDB:3THJ}.; BINDING 246 246 Substrate. {ECO:0000250|UniProtKB:P53608}.; BINDING 277 277 Substrate. {ECO:0000250|UniProtKB:P78540}.
Catalytic Activity: Reaction=H2O + L-arginine = L-ornithine + urea; Xref=Rhea:RHEA:20569, ChEBI:CHEBI:15377, ChEBI:CHEBI:16199, ChEBI:CHEBI:32682, ChEBI:CHEBI:46911; EC=3.5.3.1; Evidence={ECO:0000269|PubMed:16141327, ECO:0000269|PubMed:17562323};
Cofactor:Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000269|PubMed:16141327, ECO:0000269|PubMed:17469833, ECO:0000269|PubMed:17562323, ECO:0000269|PubMed:18802628}; Note=Binds 2 manganese ions per subunit. {ECO:0000269|PubMed:16141327, ECO:0000269|PubMed:17469833, ECO:0000269|PubMed:17562323, ECO:0000269|PubMed:18802628};
Function [CC]:Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys. {ECO:0000305}.; Functions in L-arginine homeostasis in nonhepatic tissues characterized by the competition between nitric oxide synthase (NOS) and arginase for the available intracellular substrate arginine. Arginine metabolism is a critical regulator of innate and adaptive immune responses. Involved in an antimicrobial effector pathway in polymorphonuclear granulocytes (PMN). Upon PMN cell death is liberated from the phagolysosome and depletes arginine in the microenvironment leading to suppressed T cell and natural killer (NK) cell proliferation and cytokine secretion (PubMed:15546957, PubMed:16709924, PubMed:19380772). In group 2 innate lymphoid cells (ILC2s) promotes acute type 2 inflammation in the lung and is involved in optimal ILC2 proliferation but not survival (By similarity). In humans, the immunological role in the monocytic/macrophage/dendritic cell (DC) lineage is unsure. {ECO:0000250|UniProtKB:Q61176, ECO:0000269|PubMed:15546957, ECO:0000269|PubMed:16709924, ECO:0000269|PubMed:19380772}.
Metal Binding:METAL 101 101 Manganese 1. {ECO:0000244|PDB:1WVA, ECO:0000244|PDB:1WVB, ECO:0000244|PDB:2AEB, ECO:0000244|PDB:2PHA, ECO:0000244|PDB:2PHO, ECO:0000244|PDB:2PLL, ECO:0000244|PDB:2ZAV, ECO:0000244|PDB:3DJ8, ECO:0000244|PDB:3E6K, ECO:0000244|PDB:3E6V, ECO:0000244|PDB:3F80, ECO:0000244|PDB:3GMZ, ECO:0000244|PDB:3GN0, ECO:0000244|PDB:3KV2, ECO:0000244|PDB:3LP4, ECO:0000244|PDB:3LP7, ECO:0000244|PDB:3MFV, ECO:0000244|PDB:3MFW, ECO:0000244|PDB:3MJL, ECO:0000244|PDB:3SJT, ECO:0000244|PDB:3SKK, ECO:0000244|PDB:4FCI, ECO:0000244|PDB:4GSZ, ECO:0000244|PDB:4GWC, ECO:0000244|PDB:4GWD, ECO:0000244|PDB:4HWW, ECO:0000244|PDB:4HXQ, ECO:0000244|PDB:4IE1, ECO:0000269|PubMed:16141327, ECO:0000269|PubMed:17469833, ECO:0000269|PubMed:17562323, ECO:0000269|PubMed:18802628}.; METAL 124 124 Manganese 1. {ECO:0000244|PDB:1WVA, ECO:0000244|PDB:1WVB, ECO:0000244|PDB:2AEB, ECO:0000244|PDB:2PHA, ECO:0000244|PDB:2PHO, ECO:0000244|PDB:2PLL, ECO:0000244|PDB:2ZAV, ECO:0000244|PDB:3DJ8, ECO:0000244|PDB:3E6K, ECO:0000244|PDB:3E6V, ECO:0000244|PDB:3F80, ECO:0000244|PDB:3GMZ, ECO:0000244|PDB:3GN0, ECO:0000244|PDB:3KV2, ECO:0000244|PDB:3LP4, ECO:0000244|PDB:3LP7, ECO:0000244|PDB:3MFV, ECO:0000244|PDB:3MFW, ECO:0000244|PDB:3MJL, ECO:0000244|PDB:3SJT, ECO:0000244|PDB:3SKK, ECO:0000244|PDB:4FCI, ECO:0000244|PDB:4GSZ, ECO:0000244|PDB:4GWC, ECO:0000244|PDB:4GWD, ECO:0000244|PDB:4HWW, ECO:0000244|PDB:4HXQ, ECO:0000244|PDB:4IE1, ECO:0000269|PubMed:16141327, ECO:0000269|PubMed:17469833, ECO:0000269|PubMed:17562323, ECO:0000269|PubMed:18802628}.; METAL 124 124 Manganese 2. {ECO:0000244|PDB:1WVA, ECO:0000244|PDB:1WVB, ECO:0000244|PDB:2AEB, ECO:0000244|PDB:2PHA, ECO:0000244|PDB:2PHO, ECO:0000244|PDB:2PLL, ECO:0000244|PDB:2ZAV, ECO:0000244|PDB:3DJ8, ECO:0000244|PDB:3E6K, ECO:0000244|PDB:3E6V, ECO:0000244|PDB:3F80, ECO:0000244|PDB:3GMZ, ECO:0000244|PDB:3GN0, ECO:0000244|PDB:3KV2, ECO:0000244|PDB:3LP4, ECO:0000244|PDB:3LP7, ECO:0000244|PDB:3MFV, ECO:0000244|PDB:3MFW, ECO:0000244|PDB:3MJL, ECO:0000244|PDB:3SJT, ECO:0000244|PDB:3SKK, ECO:0000244|PDB:4FCI, ECO:0000244|PDB:4GSZ, ECO:0000244|PDB:4GWC, ECO:0000244|PDB:4GWD, ECO:0000244|PDB:4HWW, ECO:0000244|PDB:4HXQ, ECO:0000244|PDB:4IE1, ECO:0000269|PubMed:16141327, ECO:0000269|PubMed:17469833, ECO:0000269|PubMed:17562323, ECO:0000269|PubMed:18802628}.; METAL 126 126 Manganese 2. {ECO:0000244|PDB:1WVA, ECO:0000244|PDB:1WVB, ECO:0000244|PDB:2AEB, ECO:0000244|PDB:2PHA, ECO:0000244|PDB:2PHO, ECO:0000244|PDB:2PLL, ECO:0000244|PDB:2ZAV, ECO:0000244|PDB:3DJ8, ECO:0000244|PDB:3E6K, ECO:0000244|PDB:3E6V, ECO:0000244|PDB:3F80, ECO:0000244|PDB:3GMZ, ECO:0000244|PDB:3GN0, ECO:0000244|PDB:3KV2, ECO:0000244|PDB:3LP4, ECO:0000244|PDB:3LP7, ECO:0000244|PDB:3MFV, ECO:0000244|PDB:3MFW, ECO:0000244|PDB:3MJL, ECO:0000244|PDB:3SJT, ECO:0000244|PDB:3SKK, ECO:0000244|PDB:4FCI, ECO:0000244|PDB:4GSZ, ECO:0000244|PDB:4GWC, ECO:0000244|PDB:4GWD, ECO:0000244|PDB:4HWW, ECO:0000244|PDB:4HXQ, ECO:0000244|PDB:4IE1, ECO:0000269|PubMed:16141327, ECO:0000269|PubMed:17469833, ECO:0000269|PubMed:17562323, ECO:0000269|PubMed:18802628}.; METAL 128 128 Manganese 1. {ECO:0000244|PDB:1WVA, ECO:0000244|PDB:1WVB, ECO:0000244|PDB:2AEB, ECO:0000244|PDB:2PHA, ECO:0000244|PDB:2PHO, ECO:0000244|PDB:2PLL, ECO:0000244|PDB:2ZAV, ECO:0000244|PDB:3DJ8, ECO:0000244|PDB:3E6K, ECO:0000244|PDB:3E6V, ECO:0000244|PDB:3F80, ECO:0000244|PDB:3GMZ, ECO:0000244|PDB:3GN0, ECO:0000244|PDB:3KV2, ECO:0000244|PDB:3LP4, ECO:0000244|PDB:3LP7, ECO:0000244|PDB:3MFV, ECO:0000244|PDB:3MFW, ECO:0000244|PDB:3MJL, ECO:0000244|PDB:3SJT, ECO:0000244|PDB:3SKK, ECO:0000244|PDB:4FCI, ECO:0000244|PDB:4GSZ, ECO:0000244|PDB:4GWC, ECO:0000244|PDB:4GWD, ECO:0000244|PDB:4HWW, ECO:0000244|PDB:4HXQ, ECO:0000244|PDB:4IE1, ECO:0000269|PubMed:16141327, ECO:0000269|PubMed:17469833, ECO:0000269|PubMed:17562323, ECO:0000269|PubMed:18802628}.; METAL 232 232 Manganese 1. {ECO:0000244|PDB:1WVA, ECO:0000244|PDB:1WVB, ECO:0000244|PDB:2AEB, ECO:0000244|PDB:2PHA, ECO:0000244|PDB:2PHO, ECO:0000244|PDB:2PLL, ECO:0000244|PDB:2ZAV, ECO:0000244|PDB:3DJ8, ECO:0000244|PDB:3E6K, ECO:0000244|PDB:3E6V, ECO:0000244|PDB:3F80, ECO:0000244|PDB:3GMZ, ECO:0000244|PDB:3GN0, ECO:0000244|PDB:3KV2, ECO:0000244|PDB:3LP4, ECO:0000244|PDB:3LP7, ECO:0000244|PDB:3MFV, ECO:0000244|PDB:3MFW, ECO:0000244|PDB:3MJL, ECO:0000244|PDB:3SJT, ECO:0000244|PDB:3SKK, ECO:0000244|PDB:4FCI, ECO:0000244|PDB:4GSZ, ECO:0000244|PDB:4GWC, ECO:0000244|PDB:4GWD, ECO:0000244|PDB:4HWW, ECO:0000244|PDB:4HXQ, ECO:0000244|PDB:4IE1, ECO:0000269|PubMed:16141327, ECO:0000269|PubMed:17469833, ECO:0000269|PubMed:17562323, ECO:0000269|PubMed:18802628}.; METAL 232 232 Manganese 2. {ECO:0000244|PDB:1WVA, ECO:0000244|PDB:1WVB, ECO:0000244|PDB:2AEB, ECO:0000244|PDB:2PHA, ECO:0000244|PDB:2PHO, ECO:0000244|PDB:2PLL, ECO:0000244|PDB:2ZAV, ECO:0000244|PDB:3DJ8, ECO:0000244|PDB:3E6K, ECO:0000244|PDB:3E6V, ECO:0000244|PDB:3F80, ECO:0000244|PDB:3GMZ, ECO:0000244|PDB:3GN0, ECO:0000244|PDB:3KV2, ECO:0000244|PDB:3LP4, ECO:0000244|PDB:3LP7, ECO:0000244|PDB:3MFV, ECO:0000244|PDB:3MFW, ECO:0000244|PDB:3MJL, ECO:0000244|PDB:3SJT, ECO:0000244|PDB:3SKK, ECO:0000244|PDB:4FCI, ECO:0000244|PDB:4GSZ, ECO:0000244|PDB:4GWC, ECO:0000244|PDB:4GWD, ECO:0000244|PDB:4HWW, ECO:0000244|PDB:4HXQ, ECO:0000244|PDB:4IE1, ECO:0000269|PubMed:16141327, ECO:0000269|PubMed:17469833, ECO:0000269|PubMed:17562323, ECO:0000269|PubMed:18802628}.; METAL 234 234 Manganese 2. {ECO:0000244|PDB:1WVA, ECO:0000244|PDB:1WVB, ECO:0000244|PDB:2AEB, ECO:0000244|PDB:2PHA, ECO:0000244|PDB:2PHO, ECO:0000244|PDB:2PLL, ECO:0000244|PDB:2ZAV, ECO:0000244|PDB:3DJ8, ECO:0000244|PDB:3E6K, ECO:0000244|PDB:3E6V, ECO:0000244|PDB:3F80, ECO:0000244|PDB:3GMZ, ECO:0000244|PDB:3GN0, ECO:0000244|PDB:3KV2, ECO:0000244|PDB:3LP4, ECO:0000244|PDB:3LP7, ECO:0000244|PDB:3MFV, ECO:0000244|PDB:3MFW, ECO:0000244|PDB:3MJL, ECO:0000244|PDB:3SJT, ECO:0000244|PDB:3SKK, ECO:0000244|PDB:4FCI, ECO:0000244|PDB:4GSZ, ECO:0000244|PDB:4GWC, ECO:0000244|PDB:4GWD, ECO:0000244|PDB:4HWW, ECO:0000244|PDB:4HXQ, ECO:0000244|PDB:4IE1, ECO:0000269|PubMed:16141327, ECO:0000269|PubMed:17469833, ECO:0000269|PubMed:17562323, ECO:0000269|PubMed:18802628}.
Induction:By arginine or homoarginine.
Tissue Specificity:Within the immune system initially reported to be selectively expressed in granulocytes (polymorphonuclear leukocytes [PMNs]) (PubMed:15546957). Also detected in macrophages mycobacterial granulomas (PubMed:23749634). Expressed in group2 innate lymphoid cells (ILC2s) during lung disease (PubMed:27043409). {ECO:0000269|PubMed:15546957, ECO:0000269|PubMed:23749634}.
Chemical Profile | ChEBI:H2O [CHEBI:15377]; urea [CHEBI:16199]; L-arginine [CHEBI:32682]; Mn(2+) [CHEBI:29035]; L-ornithine [CHEBI:46911]
ChEBI (Catalytic Activity):H2O [CHEBI:15377]; urea [CHEBI:16199]; L-arginine [CHEBI:32682]; L-ornithine [CHEBI:46911]
ChEBI (Cofactor):Mn(2+) [CHEBI:29035]
Disease:Argininemia (ARGIN) [MIM:207800]: A rare autosomal recessive disorder of the urea cycle. Arginine is elevated in the blood and cerebrospinal fluid, and periodic hyperammonemia occurs. Clinical manifestations include developmental delay, seizures, mental retardation, hypotonia, ataxia and progressive spastic quadriplegia. {ECO:0000269|PubMed:1463019, ECO:0000269|PubMed:22959135, ECO:0000269|PubMed:23859858, ECO:0000269|PubMed:7649538}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Reagent Data
Name:Arginase 1
Subcategory:Protein
Region:Met 1 - Lys 322
Molecular Weight:35.6
Source:HEK293
Species:Human
Tag:His
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.