PLAU
Human Recombinant PLAU - His Tagged
Reference ID:KB-3934
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:PLAU
Protein Names:Urokinase-type plasminogen activator (U-plasminogen activator) (uPA) (EC 3.4.21.73) [Cleaved into: Urokinase-type plasminogen activator long chain A; Urokinase-type plasminogen activator short chain A; Urokinase-type plasminogen activator chain B]
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):485.07
Length (aa):431
Sequence:MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 10
Active Site:ACT_SITE 224 224 Charge relay system.; ACT_SITE 275 275 Charge relay system.; ACT_SITE 376 376 Charge relay system.
Activity Regulation: Inhibited by SERPINA5. {ECO:0000269|PubMed:14696115, ECO:0000269|PubMed:3501295}.
Catalytic Activity: Reaction=Specific cleavage of Arg-|-Val bond in plasminogen to form plasmin.; EC=3.4.21.73;
Function [CC]:Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Site:SITE 177 178 Cleavage; during zymogen activation.
Tissue Specificity:Expressed in the prostate gland and prostate cancers. {ECO:0000269|PubMed:15988036}.
Disease:Quebec platelet disorder (QPD) [MIM:601709]: An autosomal dominant bleeding disorder due to a gain-of-function defect in fibrinolysis. Although affected individuals do not exhibit systemic fibrinolysis, they show delayed onset bleeding after challenge, such as surgery. The hallmark of the disorder is markedly increased PLAU levels within platelets, which causes intraplatelet plasmin generation and secondary degradation of alpha-granule proteins. {ECO:0000269|PubMed:20007542}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Mutagenesis:MUTAGEN 158 158 S->E: Abolishes phosphorylation, proadhesive function and ability to induce chemotactic response; when associated with E-323. {ECO:0000269|PubMed:9151681}.; MUTAGEN 323 323 S->E: Abolishes phosphorylation, proadhesive function and ability to induce chemotactic response; when associated with E-158. {ECO:0000269|PubMed:9151681}.
Pharmaceutical Application:Rx: Available under the name Abbokinase (Abbott). Used in Pulmonary Embolism (PE) to initiate fibrinolysis. Clinically used for therapy of thrombolytic disorders.
Reagent Data
Name:PLAU
Subcategory:Enzyme
Region:Ser 21 - Leu 431
Molecular Weight:45
Source:HEK293
Species:Human
Tag:His
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.