MMP-9
Human Recombinant MMP9 - His Tagged
Reference ID:KB-3929
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:MMP9;CLG4B
Protein Names:Matrix metalloproteinase-9 (MMP-9) (EC 3.4.24.35) (92 kDa gelatinase) (92 kDa type IV collagenase) (Gelatinase B) (GELB) [Cleaved into: 67 kDa matrix metalloproteinase-9; 82 kDa matrix metalloproteinase-9]
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):784.58
Length (aa):707
Sequence:MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 20
Active Site:ACT_SITE 402 402
Activity Regulation: Inhibited by histatin-3 1/24 (histatin-5). Inhibited by ECM1. {ECO:0000269|PubMed:11179305, ECO:0000269|PubMed:16512877}.
Catalytic Activity: Reaction=Cleavage of gelatin types I and V and collagen types IV and V.; EC=3.4.24.35; Evidence={ECO:0000269|PubMed:1480034};
Cofactor:Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Note=Binds 2 Zn(2+) ions per subunit.; Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Note=Binds 3 Ca(2+) ions per subunit.;
Function [CC]:May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide. {ECO:0000269|PubMed:1480034}.
Metal Binding:METAL 99 99 Zinc 2; in inhibited form. {ECO:0000269|PubMed:12051944, ECO:0000269|PubMed:12077439}.; METAL 131 131 Calcium 1.; METAL 165 165 Calcium 2; via carbonyl oxygen.; METAL 175 175 Zinc 1; structural. {ECO:0000269|PubMed:12051944, ECO:0000269|PubMed:12077439}.; METAL 177 177 Zinc 1; structural. {ECO:0000269|PubMed:12051944, ECO:0000269|PubMed:12077439}.; METAL 182 182 Calcium 3.; METAL 183 183 Calcium 3; via carbonyl oxygen.; METAL 185 185 Calcium 3; via carbonyl oxygen.; METAL 187 187 Calcium 3; via carbonyl oxygen.; METAL 190 190 Zinc 1; structural. {ECO:0000269|PubMed:12051944, ECO:0000269|PubMed:12077439}.; METAL 197 197 Calcium 2; via carbonyl oxygen.; METAL 199 199 Calcium 2; via carbonyl oxygen.; METAL 201 201 Calcium 2.; METAL 203 203 Zinc 1; structural. {ECO:0000269|PubMed:12051944, ECO:0000269|PubMed:12077439}.; METAL 205 205 Calcium 3.; METAL 206 206 Calcium 1.; METAL 208 208 Calcium 1.; METAL 208 208 Calcium 3.; METAL 401 401 Zinc 2; catalytic. {ECO:0000269|PubMed:12051944, ECO:0000269|PubMed:12077439}.; METAL 405 405 Zinc 2; catalytic. {ECO:0000269|PubMed:12051944, ECO:0000269|PubMed:12077439}.; METAL 411 411 Zinc 2; catalytic. {ECO:0000269|PubMed:12051944, ECO:0000269|PubMed:12077439}.
Site:SITE 59 60 Cleavage; by MMP3.; SITE 106 107 Cleavage; by MMP3.
Induction:Activated by 4-aminophenylmercuric acetate and phorbol ester. Up-regulated by ARHGEF4, SPATA13 and APC via the JNK signaling pathway in colorectal tumor cells. {ECO:0000269|PubMed:1371271, ECO:0000269|PubMed:1400481, ECO:0000269|PubMed:19893577}.; (Microbial infection) Expression induced by M.bovis MPB83 (at protein level) (PubMed:20800577). {ECO:0000269|PubMed:20800577}.
Tissue Specificity:Detected in neutrophils (at protein level) (PubMed:7683678). Produced by normal alveolar macrophages and granulocytes. {ECO:0000269|PubMed:7683678}.
Chemical Profile | ChEBI:Zn(2+) [CHEBI:29105]; Ca(2+) [CHEBI:29108]
ChEBI (Cofactor):Zn(2+) [CHEBI:29105]; Ca(2+) [CHEBI:29108]
Disease:Intervertebral disc disease (IDD) [MIM:603932]: A common musculo-skeletal disorder caused by degeneration of intervertebral disks of the lumbar spine. It results in low-back pain and unilateral leg pain. {ECO:0000269|PubMed:18455130}. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.; Metaphyseal anadysplasia 2 (MANDP2) [MIM:613073]: A bone development disorder characterized by skeletal anomalies that resolve spontaneously with age. Clinical characteristics are evident from the first months of life and include slight shortness of stature and a mild varus deformity of the legs. Patients attain a normal stature in adolescence and show improvement or complete resolution of varus deformity of the legs and rhizomelic micromelia. {ECO:0000269|PubMed:19615667}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Mutagenesis:MUTAGEN 402 402 E->Q: Loss of activity. {ECO:0000269|PubMed:12051944}.
Miscellaneous [CC]:In the arthritis patient this enzyme might contribute to the pathogenesis of joint destruction and might constitute a useful marker of disease status.
Reagent Data
Name:MMP-9
Subcategory:Enzyme
Region:Ala 20 - Pro 469
Molecular Weight:50.8
Source:HEK293
Species:Human
Tag:His
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.