MMP-2
Human Recombinant MMP2 - His Tagged
Reference ID:KB-3928
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:MMP2;CLG4A
Protein Names:72 kDa type IV collagenase (EC 3.4.24.24) (72 kDa gelatinase) (Gelatinase A) (Matrix metalloproteinase-2) (MMP-2) (TBE-1) [Cleaved into: PEX]
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):738.82
Length (aa):660
Sequence:MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 16
Active Site:ACT_SITE 404 404 {ECO:0000255|PROSITE-ProRule:PRU10095, ECO:0000305|PubMed:10356396}.
Activity Regulation: Inhibited by histatin-3 1/24 (histatin-5). {ECO:0000269|PubMed:11179305}.
Catalytic Activity: Reaction=Cleavage of gelatin type I and collagen types IV, V, VII, X. Cleaves the collagen-like sequence Pro-Gln-Gly-|-Ile-Ala-Gly-Gln.; EC=3.4.24.24; Evidence={ECO:0000305|PubMed:11179305, ECO:0000305|PubMed:11431697, ECO:0000305|PubMed:12147339, ECO:0000305|PubMed:2834383};
Cofactor:Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={ECO:0000269|PubMed:10356396, ECO:0000269|PubMed:12147339, ECO:0000269|PubMed:21813640, ECO:0000269|PubMed:8549817}; Note=Binds 4 Ca(2+) ions per subunit. {ECO:0000269|PubMed:10356396, ECO:0000269|PubMed:21813640, ECO:0000269|PubMed:8549817}; Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000269|PubMed:10356396, ECO:0000269|PubMed:12032297, ECO:0000269|PubMed:12147339, ECO:0000269|PubMed:21813640}; Note=Binds 2 Zn(2+) ions per subunit. {ECO:0000269|PubMed:10356396, ECO:0000269|PubMed:12032297, ECO:0000269|PubMed:21813640};
Function [CC]:Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues in association with MMP14.; PEX, the C-terminal non-catalytic fragment of MMP2, posseses anti-angiogenic and anti-tumor properties and inhibits cell migration and cell adhesion to FGF2 and vitronectin. Ligand for integrinv/beta3 on the surface of blood vessels.; Isoform 2: Mediates the proteolysis of CHUK/IKKA and initiates a primary innate immune response by inducing mitochondrial-nuclear stress signaling with activation of the pro-inflammatory NF-kappaB, NFAT and IRF transcriptional pathways.
Metal Binding:METAL 102 102 Zinc 1; in inhibited form. {ECO:0000244|PDB:1CK7, ECO:0000244|PDB:1EAK, ECO:0000244|PDB:1GXD, ECO:0000269|PubMed:10356396, ECO:0000269|PubMed:12032297}.; METAL 134 134 Calcium 1. {ECO:0000244|PDB:1QIB, ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:21813640}.; METAL 168 168 Calcium 2; via carbonyl oxygen. {ECO:0000244|PDB:1EAK, ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:21813640}.; METAL 178 178 Zinc 2. {ECO:0000244|PDB:1CK7, ECO:0000244|PDB:1EAK, ECO:0000244|PDB:1GXD, ECO:0000244|PDB:1QIB, ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:10356396, ECO:0000269|PubMed:12032297, ECO:0000269|PubMed:21813640}.; METAL 180 180 Zinc 2. {ECO:0000244|PDB:1CK7, ECO:0000244|PDB:1EAK, ECO:0000244|PDB:1GXD, ECO:0000244|PDB:1QIB, ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:10356396, ECO:0000269|PubMed:12032297, ECO:0000269|PubMed:21813640}.; METAL 185 185 Calcium 3. {ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:21813640}.; METAL 186 186 Calcium 3; via carbonyl oxygen. {ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:21813640}.; METAL 193 193 Zinc 2. {ECO:0000244|PDB:1CK7, ECO:0000244|PDB:1EAK, ECO:0000244|PDB:1GXD, ECO:0000244|PDB:1QIB, ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:10356396, ECO:0000269|PubMed:12032297, ECO:0000269|PubMed:21813640}.; METAL 200 200 Calcium 2; via carbonyl oxygen. {ECO:0000244|PDB:1EAK, ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:21813640}.; METAL 202 202 Calcium 2; via carbonyl oxygen. {ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:21813640}.; METAL 204 204 Calcium 2. {ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:21813640}.; METAL 206 206 Zinc 2. {ECO:0000244|PDB:1CK7, ECO:0000244|PDB:1EAK, ECO:0000244|PDB:1GXD, ECO:0000244|PDB:1QIB, ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:10356396, ECO:0000269|PubMed:12032297, ECO:0000269|PubMed:21813640}.; METAL 208 208 Calcium 3. {ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:21813640}.; METAL 209 209 Calcium 1. {ECO:0000244|PDB:1QIB, ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:21813640}.; METAL 211 211 Calcium 1; via carbonyl oxygen. {ECO:0000244|PDB:1QIB, ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:21813640}.; METAL 211 211 Calcium 3. {ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:21813640}.; METAL 403 403 Zinc 1; catalytic. {ECO:0000244|PDB:1CK7, ECO:0000244|PDB:1EAK, ECO:0000244|PDB:1GXD, ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:10356396, ECO:0000269|PubMed:12032297, ECO:0000269|PubMed:21813640}.; METAL 407 407 Zinc 1; catalytic. {ECO:0000244|PDB:1CK7, ECO:0000244|PDB:1EAK, ECO:0000244|PDB:1GXD, ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:10356396, ECO:0000269|PubMed:12032297, ECO:0000269|PubMed:21813640}.; METAL 413 413 Zinc 1; catalytic. {ECO:0000244|PDB:1CK7, ECO:0000244|PDB:1EAK, ECO:0000244|PDB:1GXD, ECO:0000244|PDB:3AYU, ECO:0000269|PubMed:10356396, ECO:0000269|PubMed:12032297, ECO:0000269|PubMed:21813640}.; METAL 476 476 Calcium 4; via carbonyl oxygen. {ECO:0000244|PDB:1CK7, ECO:0000244|PDB:1RTG, ECO:0000269|PubMed:10356396, ECO:0000269|PubMed:8549817}.; METAL 521 521 Calcium 4; via carbonyl oxygen. {ECO:0000244|PDB:1CK7, ECO:0000244|PDB:1RTG, ECO:0000269|PubMed:10356396, ECO:0000269|PubMed:8549817}.; METAL 569 569 Calcium 4; via carbonyl oxygen. {ECO:0000244|PDB:1CK7, ECO:0000244|PDB:1RTG, ECO:0000269|PubMed:10356396, ECO:0000269|PubMed:8549817}.; METAL 618 618 Calcium 4; via carbonyl oxygen. {ECO:0000244|PDB:1CK7, ECO:0000244|PDB:1RTG, ECO:0000269|PubMed:10356396, ECO:0000269|PubMed:8549817}.
Induction:Aspirin appears to inhibit expression. {ECO:0000269|PubMed:18971601}.
Tissue Specificity:Produced by normal skin fibroblasts. PEX is expressed in a number of tumors including gliomas, breast and prostate. {ECO:0000269|PubMed:11751392}.
Chemical Profile | ChEBI:Zn(2+) [CHEBI:29105]; Ca(2+) [CHEBI:29108]
ChEBI (Cofactor):Zn(2+) [CHEBI:29105]; Ca(2+) [CHEBI:29108]
Disease:Multicentric osteolysis, nodulosis, and arthropathy (MONA) [MIM:259600]: An autosomal recessive syndrome characterized by severe multicentric osteolysis with predominant involvement of the hands and feet. Additional features include coarse face, corneal opacities, patches of thickened, hyperpigmented skin, hypertrichosis and gum hypertrophy. {ECO:0000269|PubMed:11431697, ECO:0000269|PubMed:15691365, ECO:0000269|PubMed:16542393}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Reagent Data
Name:MMP-2
Subcategory:Enzyme
Region:Ala 30 - Cys 660
Molecular Weight:71.8
Source:HEK293
Species:Human
Tag:His
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.