MMP-1
Human Recombinant MMP1 - His Tagged
Reference ID:KB-3927
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:MMP1;CLG
Protein Names:Interstitial collagenase (EC 3.4.24.7) (Fibroblast collagenase) (Matrix metalloproteinase-1) (MMP-1) [Cleaved into: 22 kDa interstitial collagenase; 27 kDa interstitial collagenase]
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):540.07
Length (aa):469
Sequence:MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 11
Active Site:ACT_SITE 219 219
Activity Regulation: Can be activated without removal of the activation peptide.
Catalytic Activity: Reaction=Cleavage of the triple helix of collagen at about three-quarters of the length of the molecule from the N-terminus, at 775-Gly-|-Ile-776 in the alpha-1(I) chain. Cleaves synthetic substrates and alpha-macroglobulins at bonds where P1' is a hydrophobic residue.; EC=3.4.24.7; Evidence={ECO:0000269|PubMed:1645757, ECO:0000269|PubMed:16807369, ECO:0000269|PubMed:2153297, ECO:0000269|PubMed:2557822};
Cofactor:Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754, ECO:0000269|PubMed:8090713, ECO:0000269|PubMed:8278810, ECO:0000269|PubMed:9484219}; Note=Binds 4 Ca(2+) ions per subunit. {ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754, ECO:0000269|PubMed:8090713, ECO:0000269|PubMed:8278810, ECO:0000269|PubMed:9484219}; Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754, ECO:0000269|PubMed:8090713, ECO:0000269|PubMed:8278810, ECO:0000269|PubMed:9484219}; Note=Binds 2 Zn(2+) ions per subunit. {ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754, ECO:0000269|PubMed:8090713, ECO:0000269|PubMed:8278810, ECO:0000269|PubMed:9484219};
Function [CC]:Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X (PubMed:2557822, PubMed:2153297, PubMed:1645757). In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity (PubMed:16807369). {ECO:0000269|PubMed:1645757, ECO:0000269|PubMed:16807369, ECO:0000269|PubMed:2153297, ECO:0000269|PubMed:2557822}.
Metal Binding:METAL 92 92 Zinc 2; in inhibited form. {ECO:0000244|PDB:1SU3, ECO:0000269|PubMed:15611040}.; METAL 124 124 Calcium 1. {ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:3SHI, ECO:0000244|PDB:966C, ECO:0000269|PubMed:8031754}.; METAL 158 158 Calcium 2. {ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:2TCL, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:966C, ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754}.; METAL 168 168 Zinc 1. {ECO:0000244|PDB:1AYK, ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1CGL, ECO:0000244|PDB:1HFC, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2AYK, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:2TCL, ECO:0000244|PDB:3AYK, ECO:0000244|PDB:3SHI, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:4AYK, ECO:0000244|PDB:966C, ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754, ECO:0000269|PubMed:8090713, ECO:0000269|PubMed:8278810, ECO:0000269|PubMed:9484219}.; METAL 170 170 Zinc 1. {ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1CGL, ECO:0000244|PDB:1HFC, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2AYK, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:2TCL, ECO:0000244|PDB:3SHI, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:966C, ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754, ECO:0000269|PubMed:8090713, ECO:0000269|PubMed:8278810, ECO:0000269|PubMed:9484219}.; METAL 175 175 Calcium 3. {ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1CGL, ECO:0000244|PDB:1HFC, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:2TCL, ECO:0000244|PDB:3SHI, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:966C, ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754, ECO:0000269|PubMed:8090713, ECO:0000269|PubMed:8278810}.; METAL 176 176 Calcium 3; via carbonyl oxygen. {ECO:0000244|PDB:1AYK, ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1CGL, ECO:0000244|PDB:1HFC, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2AYK, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:2TCL, ECO:0000244|PDB:3SHI, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:4AYK, ECO:0000244|PDB:966C, ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754, ECO:0000269|PubMed:8090713, ECO:0000269|PubMed:8278810, ECO:0000269|PubMed:9484219}.; METAL 178 178 Calcium 3; via carbonyl oxygen. {ECO:0000244|PDB:1AYK, ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1CGL, ECO:0000244|PDB:1HFC, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2AYK, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:2TCL, ECO:0000244|PDB:3SHI, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:966C, ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754, ECO:0000269|PubMed:8090713, ECO:0000269|PubMed:8278810, ECO:0000269|PubMed:9484219}.; METAL 180 180 Calcium 3; via carbonyl oxygen. {ECO:0000244|PDB:1AYK, ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1CGL, ECO:0000244|PDB:1HFC, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2AYK, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:2TCL, ECO:0000244|PDB:3SHI, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:966C, ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754, ECO:0000269|PubMed:8090713, ECO:0000269|PubMed:8278810, ECO:0000269|PubMed:9484219}.; METAL 183 183 Zinc 1. {ECO:0000244|PDB:1AYK, ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1CGL, ECO:0000244|PDB:1HFC, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2AYK, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:2TCL, ECO:0000244|PDB:3AYK, ECO:0000244|PDB:3SHI, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:4AYK, ECO:0000244|PDB:966C, ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754, ECO:0000269|PubMed:8090713, ECO:0000269|PubMed:8278810, ECO:0000269|PubMed:9484219}.; METAL 190 190 Calcium 2; via carbonyl oxygen. {ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:2TCL, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:966C, ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754}.; METAL 192 192 Calcium 2; via carbonyl oxygen. {ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:2TCL, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:966C, ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754}.; METAL 194 194 Calcium 2. {ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:2TCL, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:966C, ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754}.; METAL 196 196 Zinc 1. {ECO:0000244|PDB:1AYK, ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1CGL, ECO:0000244|PDB:1HFC, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2AYK, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:2TCL, ECO:0000244|PDB:3AYK, ECO:0000244|PDB:3SHI, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:4AYK, ECO:0000244|PDB:966C, ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754, ECO:0000269|PubMed:8090713, ECO:0000269|PubMed:8278810, ECO:0000269|PubMed:9484219}.; METAL 198 198 Calcium 3. {ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1CGL, ECO:0000244|PDB:1HFC, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:2TCL, ECO:0000244|PDB:3AYK, ECO:0000244|PDB:3SHI, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:4AYK, ECO:0000244|PDB:966C, ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754, ECO:0000269|PubMed:8090713, ECO:0000269|PubMed:8278810}.; METAL 199 199 Calcium 1. {ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:3SHI, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:966C, ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:8031754}.; METAL 201 201 Calcium 3. {ECO:0000244|PDB:1AYK, ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1CGL, ECO:0000244|PDB:1HFC, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2AYK, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:2TCL, ECO:0000244|PDB:3AYK, ECO:0000244|PDB:3SHI, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:966C, ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754, ECO:0000269|PubMed:8090713, ECO:0000269|PubMed:8278810, ECO:0000269|PubMed:9484219}.; METAL 218 218 Zinc 2; catalytic. {ECO:0000244|PDB:1AYK, ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1CGL, ECO:0000244|PDB:1HFC, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2AYK, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:2TCL, ECO:0000244|PDB:3AYK, ECO:0000244|PDB:3SHI, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:4AYK, ECO:0000244|PDB:966C, ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754, ECO:0000269|PubMed:8090713, ECO:0000269|PubMed:8278810, ECO:0000269|PubMed:9484219}.; METAL 222 222 Zinc 2; catalytic. {ECO:0000244|PDB:1AYK, ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1CGL, ECO:0000244|PDB:1HFC, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2AYK, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:2TCL, ECO:0000244|PDB:3AYK, ECO:0000244|PDB:3SHI, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:4AYK, ECO:0000244|PDB:966C, ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754, ECO:0000269|PubMed:8090713, ECO:0000269|PubMed:8278810, ECO:0000269|PubMed:9484219}.; METAL 228 228 Zinc 2; catalytic. {ECO:0000244|PDB:1AYK, ECO:0000244|PDB:1CGE, ECO:0000244|PDB:1CGF, ECO:0000244|PDB:1CGL, ECO:0000244|PDB:1HFC, ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2AYK, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:2J0T, ECO:0000244|PDB:2TCL, ECO:0000244|PDB:3AYK, ECO:0000244|PDB:3SHI, ECO:0000244|PDB:4AUO, ECO:0000244|PDB:4AYK, ECO:0000244|PDB:966C, ECO:0000269|PubMed:15611040, ECO:0000269|PubMed:7656013, ECO:0000269|PubMed:8031754, ECO:0000269|PubMed:8090713, ECO:0000269|PubMed:8278810, ECO:0000269|PubMed:9484219}.; METAL 285 285 Calcium 4; via carbonyl oxygen. {ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:4AUO, ECO:0000269|PubMed:15611040}.; METAL 329 329 Calcium 4; via carbonyl oxygen. {ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:4AUO, ECO:0000269|PubMed:15611040}.; METAL 378 378 Calcium 4; via carbonyl oxygen. {ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:4AUO, ECO:0000269|PubMed:15611040}.; METAL 427 427 Calcium 4; via carbonyl oxygen. {ECO:0000244|PDB:1SU3, ECO:0000244|PDB:2CLT, ECO:0000244|PDB:4AUO, ECO:0000269|PubMed:15611040}.
Site:SITE 143 143 Not glycosylated. {ECO:0000269|PubMed:10092871}.; SITE 269 270 Cleavage; by autolysis. {ECO:0000269|PubMed:2557822}.
Chemical Profile | ChEBI:Zn(2+) [CHEBI:29105]; Ca(2+) [CHEBI:29108]
ChEBI (Cofactor):Zn(2+) [CHEBI:29105]; Ca(2+) [CHEBI:29108]
Mutagenesis:MUTAGEN 360 360 Y->F: Partial reduction of tyrosine phosphorylation in the presence of PKDCC/VLK. {ECO:0000269|PubMed:25171405}.
Reagent Data
Name:MMP-1
Subcategory:Enzyme
Region:Phe 20 - Asn 469
Molecular Weight:52.7
Source:HEK293
Species:Human
Tag:His
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.