CNDP1
Human Recombinant CNDP1 - His Tagged
Reference ID:KB-3916
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:CNDP1;CN1;CPGL2;UNQ1915/PRO4380
Protein Names:Beta-Ala-His dipeptidase (EC 3.4.13.20) (CNDP dipeptidase 1) (Carnosine dipeptidase 1) (Glutamate carboxypeptidase-like protein 2) (Serum carnosinase)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):567.06
Length (aa):507
Sequence:MDPKLGRMAASLLAVLLLLLERGMFSSPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPIILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQLH
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 18
Polymorphism: The number of trinucleotide (CTG) repeat varies among different alleles leading to insertion of Leu residues in the signal peptide. The allele with 5 leucines (as shown in the reference entry) is known as the Mannheim allele. Diabetic patients with the CNDP1 Mannheim allele are less susceptible for nephropathy. {ECO:0000269|PubMed:16046297}.
Active Site:ACT_SITE 134 134 {ECO:0000250}.; ACT_SITE 199 199 Proton acceptor. {ECO:0000250}.
Activity Regulation: Inhibited by the metal chelator 1,10-o-phenantrolin. The inhibitory concentration 50% (IC(50)) is 5 uM.
Catalytic Activity: Reaction=Preferential hydrolysis of the beta-Ala-|-His dipeptide (carnosine), and also anserine, Xaa-|-His dipeptides and other dipeptides including homocarnosine.; EC=3.4.13.20; Evidence={ECO:0000269|PubMed:12473676, ECO:0000269|PubMed:7116644};
Cofactor:Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000269|Ref.10}; Note=Binds 2 Zn(2+) ions per subunit. {ECO:0000269|Ref.10};
Kinetics:BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=1.27 uM for carnosine (at 30 degrees Celsius and in the absence of cadmium ions) {ECO:0000269|PubMed:12473676}; KM=11.00 uM for carnosine (at 30 degrees Celsius and in the presence of 200 uM cadmium ions) {ECO:0000269|PubMed:12473676}; KM=0.20 uM for homocarnosine (at 30 degrees Celsius and in the absence of cadmium ions) {ECO:0000269|PubMed:12473676}; KM=1.0 uM for homocarnosine (at 30 degrees Celsius and in the presence of 200 uM cadmium ions) {ECO:0000269|PubMed:12473676}; Note=1 hour incubation in 50 mM Tris-HCl, pH 7.5.;
Metal Binding:METAL 132 132 Zinc 2.; METAL 165 165 Zinc 1.; METAL 165 165 Zinc 2.; METAL 200 200 Zinc 1.; METAL 228 228 Zinc 2.; METAL 478 478 Zinc 1.
Tissue Specificity:Found in serum and adult nervous central system. Absent in serum from patients with homocarnosinosis. {ECO:0000269|PubMed:12473676, ECO:0000269|PubMed:6616870}.
Chemical Profile | ChEBI:Zn(2+) [CHEBI:29105]
ChEBI (Cofactor):Zn(2+) [CHEBI:29105]
Mutagenesis:MUTAGEN 132 132 H->A: Loss of activity. {ECO:0000269|PubMed:12473676}.; MUTAGEN 165 165 D->A: Loss of activity. {ECO:0000269|PubMed:12473676}.; MUTAGEN 200 200 E->A: Loss of activity. {ECO:0000269|PubMed:12473676}.
Reagent Data
Name:CNDP1
Subcategory:Enzyme
Region:Ser 28 - His 508
Molecular Weight:54.7
Source:HEK293
Species:Human
Tag:His
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.