TFPI
Human Recombinant TFPI - His Tagged
Reference ID:KB-3877
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:TFPI;LACI;TFPI1
Protein Names:Tissue factor pathway inhibitor (TFPI) (Extrinsic pathway inhibitor) (EPI) (Lipoprotein-associated coagulation inhibitor) (LACI)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):350.15
Length (aa):304
Sequence:MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIFVKNM
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 2
Function [CC]:Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
Site:SITE 64 65 Reactive bond.; SITE 135 136 Reactive bond.; SITE 227 228 Reactive bond.; SITE 256 256 Not glycosylated.
Tissue Specificity:Mostly in endothelial cells.
Mutagenesis:MUTAGEN 64 64 K->I: Abolishes inhibition of VII(a)/TF.; MUTAGEN 135 135 R->L: Abolishes inhibition of X(a).; MUTAGEN 227 227 R->L: Abolishes inhibition of VII(a)/TF.
Reagent Data
Name:TFPI
Class:Protease Inhibitor
Subcategory:Protein
Region:Asp 29 - Lys 282
Molecular Weight:30
Source:HEK293
Species:Human
Tag:His
Conjugation:Lysine side chain Biotin
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.