FAM3B
Human Recombinant FAM3B - Fc Tagged
Reference ID:KB-3876
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:FAM3B;C21orf11;C21orf76;PRED44;UNQ320/PRO365
Protein Names:Protein FAM3B (Cytokine-like protein 2-21) (Pancreatic-derived factor) (PANDER)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):259.82
Length (aa):235
Sequence:MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 21
Function [CC]:Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner. {ECO:0000269|PubMed:16114871}.
Tissue Specificity:Highly expressed in the pancreas. Also found in the colon, kidney, prostate, small intestine and testis. {ECO:0000269|PubMed:16114871}.
Reagent Data
Name:FAM3B
Class:Predicted Membrane
Subcategory:Protein
Region:Glu 30 - Ser 235
Molecular Weight:49.5
Source:HEK293
Species:Human
Tag:Fc
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.