PD-L2
Mouse Recombinant Pdcd1lg2 - Fc Tagged
Reference ID:KB-3845
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:Pdcd1lg2;B7dc;Btdc;Cd273;Pdl2
Protein Names:Programmed cell death 1 ligand 2 (PD-1 ligand 2) (PD-L2) (PDCD1 ligand 2) (Programmed death ligand 2) (Butyrophilin B7-DC) (B7-DC) (CD antigen CD273)
Accession Data
Organism:Mus musculus (Mouse)
Mass (kDa):278.20
Length (aa):247
Sequence:MLLLLPILNLSLQLHPVAALFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPRTWPLHVFIPACTIALIFLAIVIIQRKRI
Proteomics (Proteome ID):UP000000589
Proteomics (Chromosome): Chromosome 19
Function [CC]:Involved in the costimulatory signal essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production. {ECO:0000269|PubMed:11224527, ECO:0000269|PubMed:11283156, ECO:0000269|PubMed:12719480}.
Tissue Specificity:Expressed in immature and mature bone marrow-derived dendritic cells and splenic dendritic cells. Highly expressed in placenta, liver and weakly expressed in heart, spleen, lymph nodes and thymus. Also expressed in some tumor cell lines of lymphoid origin. {ECO:0000269|PubMed:11224527, ECO:0000269|PubMed:11283156}.
Mutagenesis:MUTAGEN 33 33 D->S: No effect on PDCD1 binding. {ECO:0000269|PubMed:12719480}.; MUTAGEN 39 39 S->Y: No effect on PDCD1 binding. {ECO:0000269|PubMed:12719480}.; MUTAGEN 41 41 E->S: No effect on PDCD1 binding. {ECO:0000269|PubMed:12719480}.; MUTAGEN 56 56 R->S: Significantly reduces the binding to PDCD1. {ECO:0000269|PubMed:12719480}.; MUTAGEN 58 58 S->Y: No effect on PDCD1 binding. {ECO:0000269|PubMed:12719480}.; MUTAGEN 65 65 D->S: No effect on PDCD1 binding. {ECO:0000269|PubMed:12719480}.; MUTAGEN 67 67 S->Y: Significantly reduces the binding to PDCD1. {ECO:0000269|PubMed:12719480}.; MUTAGEN 71 71 E->S: Significantly reduces the binding to PDCD1. {ECO:0000269|PubMed:12719480}.; MUTAGEN 72 72 R->S: No effect on PDCD1 binding. {ECO:0000269|PubMed:12719480}.; MUTAGEN 84 84 K->S: No effect on PDCD1 binding. {ECO:0000269|PubMed:12719480}.; MUTAGEN 88 88 H->A: No effect on PDCD1 binding. {ECO:0000269|PubMed:12719480}.; MUTAGEN 101 101 R->S: Significantly reduces the binding to PDCD1. {ECO:0000269|PubMed:12719480}.; MUTAGEN 103 103 L->A: No effect on PDCD1 binding. {ECO:0000269|PubMed:12719480}.; MUTAGEN 105 105 I->A: Abolishes the binding to PDCD1. {ECO:0000269|PubMed:12719480}.; MUTAGEN 111 111 D->S: Abolishes the binding to PDCD1. Costimulates proliferation and IFNG production of T-cells. {ECO:0000269|PubMed:12719480}.; MUTAGEN 113 113 K->S: Abolishes the binding to PDCD1. Costimulates proliferation and IFNG production of T-cells. {ECO:0000269|PubMed:12719480}.; MUTAGEN 116 116 T->Y: No effect on PDCD1 binding. {ECO:0000269|PubMed:12719480}.
Reagent Data
Name:PD-L2
Class:Immune Checkpoint
Subcategory:Protein
Region:Leu 20 - Arg 219
Molecular Weight:49.2
Source:HEK293
Species:Mouse
Tag:Fc
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.