LAG-3
Human Recombinant LAG3 - Fc Tagged
Reference ID:KB-3803
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:LAG3;FDC
Protein Names:Lymphocyte activation gene 3 protein (LAG-3) (CD antigen CD223) [Cleaved into: Secreted lymphocyte activation gene 3 protein (sLAG-3)]
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):574.49
Length (aa):525
Sequence:MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 12
Function [CC]:Lymphocyte activation gene 3 protein: Inhibitory receptor on antigen activated T-cells (PubMed:7805750, PubMed:8647185, PubMed:20421648). Delivers inhibitory signals upon binding to ligands, such as FGL1 (By similarity). FGL1 constitutes a major ligand of LAG3 and is responsible for LAG3 T-cell inhibitory function (By similarity). Following TCR engagement, LAG3 associates with CD3-TCR in the immunological synapse and directly inhibits T-cell activation (By similarity). May inhibit antigen-specific T-cell activation in synergy with PDCD1/PD-1, possibly by acting as a coreceptor for PDCD1/PD-1 (By similarity). Negatively regulates the proliferation, activation, effector function and homeostasis of both CD8(+) and CD4(+) T-cells (PubMed:7805750, PubMed:8647185, PubMed:20421648). Also mediates immune tolerance: constitutively expressed on a subset of regulatory T-cells (Tregs) and contributes to their suppressive function (By similarity). Also acts as a negative regulator of plasmacytoid dendritic cell (pDCs) activation (By similarity). Binds MHC class II (MHC-II); the precise role of MHC-II-binding is however unclear (PubMed:8647185). {ECO:0000250|UniProtKB:Q61790, ECO:0000269|PubMed:20421648, ECO:0000269|PubMed:7805750, ECO:0000269|PubMed:8647185}.; Secreted lymphocyte activation gene 3 protein: May function as a ligand for MHC class II (MHC-II) on antigen-presenting cells (APC), promoting APC activation/maturation and driving Th1 immune response. {ECO:0000250|UniProtKB:Q61790}.
Induction:Expression is induced by interleukin-2 (IL2), interleukin-7 (IL7) and interleukin-12 (IL12A and IL12B) on activated T-cells. {ECO:0000269|PubMed:9634475}.
Tissue Specificity:Primarily expressed in activated T-cells and a subset of natural killer (NK) cells. {ECO:0000269|PubMed:1380059, ECO:0000269|PubMed:1692078, ECO:0000269|PubMed:20421648}.
Mutagenesis:MUTAGEN 35 35 Q->A: Does not affect binding to MHC class II (MHC-II). {ECO:0000269|PubMed:9159144}.; MUTAGEN 52 52 D->A: Reduced binding to MHC class II (MHC-II). {ECO:0000269|PubMed:9159144}.; MUTAGEN 78 78 H->A: Reduced binding to MHC class II (MHC-II). {ECO:0000269|PubMed:9159144}.; MUTAGEN 78 78 H->F: Does not significantly affect binding to MHC class II (MHC-II). {ECO:0000269|PubMed:9159144}.; MUTAGEN 85 85 H->A,F: Does not affect binding to MHC class II (MHC-II). {ECO:0000269|PubMed:9159144}.; MUTAGEN 95 95 R->E: Increased binding to MHC class II (MHC-II). {ECO:0000269|PubMed:9159144}.; MUTAGEN 97 97 R->A,E: Increased binding to MHC class II (MHC-II). {ECO:0000269|PubMed:9159144}.; MUTAGEN 98 98 R->E: Increased binding to MHC class II (MHC-II). {ECO:0000269|PubMed:9159144}.; MUTAGEN 99 99 Y->F: Abolishes binding to MHC class II (MHC-II) without affecting interaction with FGL1. {ECO:0000269|PubMed:30580966, ECO:0000269|PubMed:9159144}.; MUTAGEN 110 110 R->A: Reduced binding to MHC class II (MHC-II). {ECO:0000269|PubMed:9159144}.; MUTAGEN 125 125 R->A: Reduced binding to MHC class II (MHC-II). {ECO:0000269|PubMed:9159144}.; MUTAGEN 129 129 R->K: Does not affect binding to MHC class II (MHC-II). {ECO:0000269|PubMed:9159144}.; MUTAGEN 131 131 D->A: Reduced binding to MHC class II (MHC-II). {ECO:0000269|PubMed:9159144}.; MUTAGEN 137 137 R->A: Reduced binding to MHC class II (MHC-II). {ECO:0000269|PubMed:9159144}.; MUTAGEN 155 156 DR->AA: Slightly affects binding to MHC class II (MHC-II). {ECO:0000269|PubMed:9159144}.; MUTAGEN 247 247 D->L: Does not affect binding to MHC class II (MHC-II). {ECO:0000269|PubMed:9159144}.
Reagent Data
Name:LAG-3
Class:Immune Checkpoint
Subcategory:Protein
Region:Leu 23 - Leu 450
Molecular Weight:72.3
Source:HEK293
Species:Human
Tag:Fc
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.