CTLA-4
Human Recombinant CTLA4 - Fc Tagged
Reference ID:KB-3776
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:CTLA4;CD152
Protein Names:Cytotoxic T-lymphocyte protein 4 (Cytotoxic T-lymphocyte-associated antigen 4) (CTLA-4) (CD antigen CD152)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):246.56
Length (aa):223
Sequence:MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 2
Polymorphism: Genetic variations in CTLA4 are associated with susceptibility to several autoimmune disorders (PubMed:18595775, PubMed:12724780, PubMed:10189842, PubMed:10924276, PubMed:15138458, PubMed:15657618, PubMed:15688186, PubMed:25329329, PubMed:25213377). They influence responsiveness to hepatitis B virus (HBV) infection [MIM:610424] (PubMed:15452244). {ECO:0000269|PubMed:10189842, ECO:0000269|PubMed:10924276, ECO:0000269|PubMed:12724780, ECO:0000269|PubMed:15138458, ECO:0000269|PubMed:15452244, ECO:0000269|PubMed:15657618, ECO:0000269|PubMed:15688186, ECO:0000269|PubMed:18595775, ECO:0000269|PubMed:25213377, ECO:0000269|PubMed:25329329}.
Function [CC]:Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28. {ECO:0000269|PubMed:16551244, ECO:0000269|PubMed:1714933}.
Tissue Specificity:Widely expressed with highest levels in lymphoid tissues. Detected in activated T-cells where expression levels are 30- to 50-fold less than CD28, the stimulatory coreceptor, on the cell surface following activation. {ECO:0000269|PubMed:10493833, ECO:0000269|PubMed:16551244, ECO:0000269|PubMed:1713603}.
Disease:Systemic lupus erythematosus (SLE) [MIM:152700]: A chronic, relapsing, inflammatory, and often febrile multisystemic disorder of connective tissue, characterized principally by involvement of the skin, joints, kidneys and serosal membranes. It is of unknown etiology, but is thought to represent a failure of the regulatory mechanisms of the autoimmune system. The disease is marked by a wide range of system dysfunctions, an elevated erythrocyte sedimentation rate, and the formation of LE cells in the blood or bone marrow. {ECO:0000269|PubMed:15138458, ECO:0000269|PubMed:15688186}. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.; Note=Genetic variations in CTLA4 may influence susceptibility to Graves disease, an autoimmune disorder associated with overactivity of the thyroid gland and hyperthyroidism. {ECO:0000269|PubMed:10924276}.; Diabetes mellitus, insulin-dependent, 12 (IDDM12) [MIM:601388]: A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical features are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. {ECO:0000269|PubMed:9259273}. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.; Celiac disease 3 (CELIAC3) [MIM:609755]: A multifactorial, chronic disorder of the small intestine caused by intolerance to gluten. It is characterized by immune-mediated enteropathy associated with failed intestinal absorption, and malnutrition. In predisposed individuals, the ingestion of gluten-containing food such as wheat and rye induces a flat jejunal mucosa with infiltration of lymphocytes. {ECO:0000269|PubMed:10189842, ECO:0000269|PubMed:15657618}. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.; Autoimmune lymphoproliferative syndrome 5 (ALPS5) [MIM:616100]: An autosomal dominant primary immunodeficiency characterized by severe autoimmunity, infiltration of non-lymphoid organs, such as the intestine, lungs and brain, by hyperactive T cells and B cells, autoimmune cytopenias, and hypogammaglobulinemia in early childhood. {ECO:0000269|PubMed:25213377, ECO:0000269|PubMed:25329329}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Mutagenesis:MUTAGEN 45 45 V->D: Strongly reduced interaction with CD80, CD86 and ICOSLG. {ECO:0000269|PubMed:28484017}.; MUTAGEN 47 47 L->D: Strongly reduced interaction with CD80, CD86 and ICOSLG. {ECO:0000269|PubMed:28484017}.; MUTAGEN 49 49 S->A: Strongly reduced interaction with CD80, CD86 and ICOSLG. {ECO:0000269|PubMed:28484017}.; MUTAGEN 70 70 R->A,D: Strongly reduced interaction with CD80, CD86 and ICOSLG. {ECO:0000269|PubMed:28484017}.; MUTAGEN 130 130 K->A,D: Strongly reduced interaction with CD80, CD86 and ICOSLG. {ECO:0000269|PubMed:28484017}.; MUTAGEN 132 132 E->A,R: Strongly reduced interaction with CD80, CD86 and ICOSLG. {ECO:0000269|PubMed:28484017}.; MUTAGEN 139 139 Y->A,D: Strongly reduced interaction with CD80, CD86 and ICOSLG. {ECO:0000269|PubMed:28484017}.; MUTAGEN 143 143 I->A,D: Strongly reduced interaction with CD80, CD86 and ICOSLG. {ECO:0000269|PubMed:28484017}.
Pharmaceutical Application:Rx: Engineered fusion proteins consisting of the extracellular domain of CTLA4 and the IgG Fc region (Ctla4-Ig), inhibit T-cell-dependent antibody responses, and are used as immunosuppressive agents. They are soluble, have an enhanced affinity for B7 ligands and act as a competitive inhibitor of CD28.
Miscellaneous [CC]:The therapeutic antibody Ipilimumab competes for the binding site of the endogenous ligands CD80/B7-1, CD86/B7-2 and ICOSLG.
Reagent Data
Name:CTLA-4
Class:Immune Checkpoint
Subcategory:Protein
Region:Ala 37 - Ser 160
Molecular Weight:40
Source:HEK293
Species:Human
Tag:Fc
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.