CD28
Mouse Recombinant Cd28 - Fc Tagged
Reference ID:KB-3751
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:Cd28
Protein Names:T-cell-specific surface glycoprotein CD28 (CD antigen CD28)
Accession Data
Organism:Mus musculus (Mouse)
Mass (kDa):252.43
Length (aa):218
Sequence:MTLRLLFLALNFFSVQVTENKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKLFWALVVVAGVLFCYGLLVTVALCVIWTNSRRNRLLQSDYMNMTPRRPGLTRKPYQPYAPARDFAAYRP
Proteomics (Proteome ID):UP000000589
Proteomics (Chromosome): Chromosome 1
Function [CC]:Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation. {ECO:0000250|UniProtKB:P10747}.
Reagent Data
Name:CD28
Class:Immune Checkpoint
Subcategory:Protein
Region:Asn 20 - Lys 149
Molecular Weight:41.7
Source:HEK293
Species:Mouse
Tag:Fc
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.