B7-H5
Mouse Recombinant Vsir - His Tagged
Reference ID:KB-3733
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:Vsir;Dies1;PD-1H;VISTA
Protein Names:V-type immunoglobulin domain-containing suppressor of T-cell activation (Platelet receptor Gi24) (V-set domain-containing immunoregulatory receptor) (V-set immunoregulatory receptor)
Accession Data
Organism:Mus musculus (Mouse)
Mass (kDa):335.59
Length (aa):308
Sequence:MGVPAVPEASSPRWGTLLLAIFLAASRGLVAAFKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAALATGACIVGILCLPLILLLVYKQRQVASHRRAQELVRMDSNTQGIENPGFETTPPFQGMPEAKTRPPLSYVAQRQPSESGRYLLSDPSTPLSPPGPGDVFFPSLDPVPDSPNSEAI
Proteomics (Proteome ID):UP000000589
Proteomics (Chromosome): Chromosome 10
Function [CC]:Immunoregulatory receptor which inhibits the T-cell response (PubMed:21383057, PubMed:24743150, PubMed:25267631). May promote differentiation of embryonic stem cells, by inhibiting BMP4 signaling (PubMed:20042595). May stimulate MMP14-mediated MMP2 activation (By similarity). {ECO:0000250|UniProtKB:Q9H7M9, ECO:0000269|PubMed:20042595, ECO:0000269|PubMed:21383057, ECO:0000269|PubMed:24743150, ECO:0000269|PubMed:25267631}.
Developmental Stage:Detected in 7-day and 17-day embryos. {ECO:0000269|PubMed:21768399}.
Induction:Up-regulated by phorbol 12-myristate 13-acetate (PMA) and the cytokine IFNG. {ECO:0000269|PubMed:21768399}.
Tissue Specificity:Expressed in spleen, thymus, bone marrow, lymph node, and in T-cells within the lamina propria of the small intestine (PubMed:21768399). Detected on CD4+ and CD8+ T-cells, bone marrow-derived dendritic cells (BMDCs), peritoneal macrophages, neutrophils, and natural killer (NK) cells (PubMed:21768399). In spleen and lymph nodes, highly expressed on CD4+ T-cell populations, and at lower levels on CD8+ T-cells (PubMed:21383057). In thymus, has low expression on CD4+ cells and CD8+ cells, and not detected on CD4+CD8+ cells (PubMed:21383057). Expressed in splenic and peritoneal CD11b cells (PubMed:21383057). Not detected in most B cells and NK cells (at protein level) (PubMed:21383057). Also detected at lower levels in non-hematopoeitic tissues such as heart, brain, lung, kidney, muscle, ovary, and testis (PubMed:21768399, PubMed:21383057). {ECO:0000269|PubMed:21383057, ECO:0000269|PubMed:21768399}.
Reagent Data
Name:B7-H5
Class:Immune Checkpoint
Subcategory:Protein
Region:Phe 33 - Ala 191
Molecular Weight:19.7
Source:HEK293
Species:Mouse
Tag:His
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.