B7-H4
Human Recombinant VTCN1 - His Tagged
Reference ID:KB-3729
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:VTCN1;B7H4;UNQ659/PRO1291
Protein Names:V-set domain-containing T-cell activation inhibitor 1 (B7 homolog 4) (B7-H4) (B7h.5) (Immune costimulatory protein B7-H4) (Protein B7S1) (T-cell costimulatory molecule B7x)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):308.78
Length (aa):282
Sequence:MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 1
Function [CC]:Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation. {ECO:0000250|UniProtKB:Q7TSP5, ECO:0000269|PubMed:15878339, ECO:0000269|PubMed:16606666, ECO:0000269|PubMed:17509674, ECO:0000269|PubMed:17875732}.
Induction:Up-regulated by IL6/interleukin-6 and IL10/interleukin-10 and inhibited by CSF2/GM-CSF and IL4/interleukin-4 on antigen-presenting cells (APCs). {ECO:0000269|PubMed:16606666, ECO:0000269|PubMed:16785496, ECO:0000269|PubMed:17875732}.
Tissue Specificity:Overexpressed in breast, ovarian, endometrial, renal cell (RCC) and non-small-cell lung cancers (NSCLC). Expressed on activated T- and B-cells, monocytes and dendritic cells, but not expressed in most normal tissues (at protein level). Widely expressed, including in kidney, liver, lung, ovary, placenta, spleen and testis. {ECO:0000269|PubMed:12818165, ECO:0000269|PubMed:14568939, ECO:0000269|PubMed:15878339, ECO:0000269|PubMed:16606666, ECO:0000269|PubMed:16782226, ECO:0000269|PubMed:16798883, ECO:0000269|PubMed:17509674}.
Miscellaneous [CC]:May serve as a predictive marker for renal cell carcinoma. {ECO:0000269|PubMed:16798883}.
Reagent Data
Name:B7-H4
Class:Immune Checkpoint
Subcategory:Protein
Region:Phe 29 - Ala 258
Molecular Weight:26.1
Source:HEK293
Species:Human
Tag:His
Conjugation:Lysine side chain Biotin
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.