B7-H3
Mouse Recombinant Cd276 - Fc Tagged
Reference ID:KB-3728
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:Cd276;B7h3
Protein Names:CD276 antigen (B7 homolog 3) (B7-H3) (Costimulatory molecule) (CD antigen CD276)
Accession Data
Organism:Mus musculus (Mouse)
Mass (kDa):340.01
Length (aa):316
Sequence:MLRGWGGPSVGVCVRTALGVLCLCLTGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFPPEALWVTVGLSVCLVVLLVALAFVCWRKIKQSCEEENAGAEDQDGDGEGSKTALRPLKPSENKEDDGQEIA
Proteomics (Proteome ID):UP000000589
Proteomics (Chromosome): Chromosome 9
Function [CC]:Modulates T-cell-mediated immune responses and the development of acute and chronic transplant rejection. Plays a positive regulatory role in bone formation and has a dual role in the bone-immune interface. Induces antitumor immunity as it activates both acquired and innate immunity leading to natural killer cell and CD8 T-cell dependent killing of tumor cells. {ECO:0000269|PubMed:12055244, ECO:0000269|PubMed:12925852, ECO:0000269|PubMed:12939639, ECO:0000269|PubMed:15294965, ECO:0000269|PubMed:15682454}.
Developmental Stage:Highly expressed in developing bones during embryogenesis and expression increases as osteoblast precursor cells differentiate into mature osteoblasts. {ECO:0000269|PubMed:12925852}.
Induction:Up-regulated in cells mediating rejection of mouse transplant. {ECO:0000269|PubMed:15682454}.
Tissue Specificity:Ubiquitous. {ECO:0000269|PubMed:12055244}.
Miscellaneous [CC]:Gene transfer of B7-H3 leads to complete regression of 50 per cent tumors, or significantly slows tumor growth.; In primates, B7-H3 locus underwent genomic duplication leading to tandemly repeated immunoglobulin-like V and C domains (VC domains). The dominantly expressed human B7-H3 isoform contains tandemly duplicated VC domains. In contrast, mouse B7-H3 transcript contains only one single VC domain form due to an exon structure corresponding to V domain-(pseudoexon C)-(pseudoexon V)-C domain. This duplication appearing in primates is suggested to be very recent supporting a model of multiple independent emergence of tandem VC repeats within human and monkey species.
Reagent Data
Name:B7-H3
Class:Immune Checkpoint
Subcategory:Protein
Region:Val 29 - Phe 244
Molecular Weight:50.1
Source:HEK293
Species:Mouse
Tag:Fc
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.