TDGF1
Human Recombinant TDGF1 - Fc Tagged
Reference ID:KB-3688
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:TDGF1;CRIPTO
Protein Names:Teratocarcinoma-derived growth factor 1 (Cripto-1 growth factor) (CRGF) (Epidermal growth factor-like cripto protein CR1)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):211.69
Length (aa):188
Sequence:MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSYY
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 3
Function [CC]:GPI-anchored cell membrane protein involved in Nodal signaling. Cell-associated TDGF1 acts as a Nodal coreceptor in cis. Shedding of TDGF1 by TMEM8A modulates Nodal signaling by allowing soluble TDGF1 to act as a Nodal coreceptor on other cells (PubMed:27881714). Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm (PubMed:11909953). {ECO:0000269|PubMed:11909953, ECO:0000269|PubMed:27881714}.
Tissue Specificity:Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts. Expressed in breast and lung. {ECO:0000269|PubMed:18835250}.
Mutagenesis:MUTAGEN 188 188 Y->YVVVVV: Alters the localization and decreases the biological activity. {ECO:0000269|PubMed:18930707}.
Reagent Data
Name:TDGF1
Class:Growth Factor
Subcategory:Protein
Region:Leu 31 - Thr 172
Molecular Weight:42.6
Source:HEK293
Species:Human
Tag:Fc
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.