CCL6
Mouse Recombinant Ccl6 - His Tagged
Reference ID:KB-3583
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:Ccl6;C10;Scya6
Protein Names:C-C motif chemokine 6 (Protein C10) (Small-inducible cytokine A6) [Cleaved into: CCL6(22-95); CCL6(23-95)]
Accession Data
Organism:Mus musculus (Mouse)
Mass (kDa):129.84
Length (aa):116
Sequence:MRNSKTAISFFILVAVLGSQAGLIQEMEKEDRRYNPPIIHQGFQDTSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTLKQGPRSGNKVIA
Proteomics (Proteome ID):UP000000589
Proteomics (Chromosome): Chromosome 11
Function [CC]:CCL6(22-95) and CCL6(23-95) are potent chemoattractants. {ECO:0000269|PubMed:15905581}.
Induction:Associated with stimuli that promote myeloid differentiation.
Tissue Specificity:Expressed in myelopoietic bone marrow cultures stimulated by GM-CSF.
Reagent Data
Name:CCL6
Class:Chemokine
Subcategory:Protein
Region:Gly 22 - Ala 116
Molecular Weight:11.4
Source:HEK293
Species:Mouse
Tag:His
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.