IL6R

Interleukin-6 receptor subunit alpha (IL-6 receptor subunit alpha) (IL-6R subunit alpha) (IL-6R-alpha) (IL-6RA) (IL-6R 1) (Membrane glycoprotein 80) (gp80) (CD antigen CD126)

Homo sapiens (Human)

51548

468

N/A

Interleukin-6 receptor subunit alpha (IL-6 receptor subunit alpha) (IL-6R subunit alpha) (IL-6R-alpha) (IL-6RA) (IL-6R 1) (Membrane glycoprotein 80) (gp80) (CD antigen CD126)

N/A

MUTAGEN 121 121 C->S: Complete loss of ligand-binding. {ECO:0000269|PubMed:8467812}.; MUTAGEN 122 122 F->A: No change of ligand-binding and IL6 signaling. {ECO:0000269|PubMed:8467812}.; MUTAGEN 132 132 C->A: Complete loss of ligand-binding. {ECO:0000269|PubMed:8467812}.; MUTAGEN 134 134 W->L: Complete loss of ligand-binding. {ECO:0000269|PubMed:8467812}.; MUTAGEN 140 140 P->G: No change of ligand-binding and IL6 signaling. {ECO:0000269|PubMed:8467812}.; MUTAGEN 153 153 F->L: No change of ligand-binding and IL6 signaling. {ECO:0000269|PubMed:8467812}.; MUTAGEN 165 165 C->L: Complete loss of ligand-binding. {ECO:0000269|PubMed:8467812}.; MUTAGEN 174 174 F->L: No change of ligand-binding and IL6 signaling. {ECO:0000269|PubMed:8467812}.; MUTAGEN 176 176 C->A: Complete loss of ligand-binding. {ECO:0000269|PubMed:8467812}.; MUTAGEN 184 184 D->T: 30% decrease of ligand-binding and IL6 signaling. {ECO:0000269|PubMed:8467812}.; MUTAGEN 190 190 V->G: 80% decrease of ligand-binding and no IL6 signaling. {ECO:0000269|PubMed:8467812}.; MUTAGEN 193 193 C->D: Complete loss of ligand-binding. {ECO:0000269|PubMed:8467812}.; MUTAGEN 211 211 C->A: No change of ligand-binding and IL6 signaling. {ECO:0000269|PubMed:8467812}.; MUTAGEN 217 217 D->V: Complete loss of ligand-binding. {ECO:0000269|PubMed:8467812}.; MUTAGEN 232 232 R->S: 30% decrease of ligand-binding and IL6 signaling. {ECO:0000269|PubMed:8467812}.; MUTAGEN 233 233 W->Q: 30% decrease of ligand-binding and increase of IL6 signaling. {ECO:0000269|PubMed:8467812}.; MUTAGEN 254 254 E->A: 50% decrease of ligand-binding and IL6 signaling. {ECO:0000269|PubMed:8467812}.; MUTAGEN 277 277 C->D: 30% increase of ligand-binding and 100% increase in IL6 signaling. {ECO:0000269|PubMed:8467812}.; MUTAGEN 278 278 V->N: 50% Decrease of ligand-binding and 50% increase in IL6 signaling. {ECO:0000269|PubMed:8467812}.; MUTAGEN 279 279 I->D: Complete loss of ligand-binding. {ECO:0000269|PubMed:8467812}.; MUTAGEN 280 280 H->I: No change of ligand-binding and no IL6 signaling. {ECO:0000269|PubMed:8467812}.; MUTAGEN 281 281 D->G: 70% decrease of ligand-binding and no IL6 signaling. {ECO:0000269|PubMed:8467812}.; MUTAGEN 285 285 G->D: 80% decrease of ligand-binding and no IL6 signaling. {ECO:0000269|PubMed:8467812}.; MUTAGEN 291 291 Q->K: Complete loss of ligand-binding. {ECO:0000269|PubMed:8467812}.; MUTAGEN 293 293 R->G: Complete loss of ligand-binding. {ECO:0000269|PubMed:8467812}.

MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR

Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis.; Low concentration of a soluble form of IL6 receptor acts as an agonist of IL6 activity.

Alternative sequence (2); Beta strand (23); Chain (1); Disulfide bond (4); Domain (3); Glycosylation (3); Helix (2); Motif (1); Mutagenesis (25); Natural variant (2); Sequence conflict (1); Signal peptide (1); Site (1); Topological domain (2); Transmembrane (1); Turn (3); Isoform 2 is expressed in peripheral blood mononuclear cells and weakly found in urine and serum.

Interleukin-6 receptor subunit alpha (IL-6 receptor subunit alpha) (IL-6R subunit alpha) (IL-6R-alpha) (IL-6RA) (IL-6R 1) (Membrane glycoprotein 80) (gp80) (CD antigen CD126)

Recombinant

HEK293

Lyophilized

7.4-7.5

Sterile-filtered colorless solution

1mg/ml

Standard

PBS

SDS-PAGE

> 98%

RP-HPLC

-20°C

This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.

Reconstitute in sterile distilled H2O to no less than 100ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.