FOLR1;FOLR

Folate receptor alpha (FR-alpha) (Adult folate-binding protein) (FBP) (Folate receptor 1) (Folate receptor, adult) (KB cells FBP) (Ovarian tumor-associated antigen MOv18)

Homo sapiens (Human)

29819

257

Pending Verification

Folate receptor alpha (FR-alpha) (Adult folate-binding protein) (FBP) (Folate receptor 1) (Folate receptor, adult) (KB cells FBP) (Ovarian tumor-associated antigen MOv18)

Neurodegeneration due to cerebral folate transport deficiency (NCFTD) [MIM:613068]: A neurodegenerative disorder resulting from brain-specific folate deficiency early in life. Onset is apparent in late infancy with severe developmental regression, movement disturbances, epilepsy and leukodystrophy. {ECO:0000269|PubMed:19732866}. Note=The disease is caused by mutations affecting the gene represented in this entry.

MUTAGEN 82 82 Y->A: Slightly reduced affinity for folate. {ECO:0000269|PubMed:23851396}.; MUTAGEN 103 103 D->A: Strongly reduced affinity for folate. {ECO:0000269|PubMed:23851396}.; MUTAGEN 107 107 Y->A: Moderately reduced affinity for folate. {ECO:0000269|PubMed:23851396}.; MUTAGEN 124 124 W->A: Moderately reduced affinity for folate. {ECO:0000269|PubMed:23851396}.; MUTAGEN 125 125 R->A: Moderately reduced affinity for folate. {ECO:0000269|PubMed:23851396}.; MUTAGEN 128 128 R->A: Moderately reduced affinity for folate. {ECO:0000269|PubMed:23851396}.; MUTAGEN 157 157 H->A: Moderately reduced affinity for folate. {ECO:0000269|PubMed:23851396}.; MUTAGEN 162 162 W->A: Moderately reduced affinity for folate. {ECO:0000269|PubMed:23851396}.; MUTAGEN 196 196 S->A: Moderately reduced affinity for folate. {ECO:0000269|PubMed:23851396}.

MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS

Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. Required for normal embryonic development and normal cell proliferation. {ECO:0000269|PubMed:23851396, ECO:0000269|PubMed:23934049, ECO:0000269|PubMed:2527252, ECO:0000269|PubMed:8033114, ECO:0000269|PubMed:8567728}.

Beta strand (7); Binding site (3); Chain (1); Disulfide bond (8); Glycosylation (3); Helix (11); Lipidation (1); Mutagenesis (9); Natural variant (2); Propeptide (1); Region (2); Sequence conflict (2); Signal peptide (1); Turn (5); Primarily expressed in tissues of epithelial origin. Expression is increased in malignant tissues. Expressed in kidney, lung and cerebellum. Detected in placenta and thymus epithelium. {ECO:0000269|PubMed:2527252, ECO:0000269|PubMed:2768245, ECO:0000269|PubMed:9063895}.

Folate receptor alpha (FR-alpha) (Adult folate-binding protein) (FBP) (Folate receptor 1) (Folate receptor, adult) (KB cells FBP) (Ovarian tumor-associated antigen MOv18)

Recombinant

HEK293

Lyophilized

7.4-7.5

Sterile-filtered colorless solution

1mg/ml

Standard

PBS

SDS-PAGE

> 98%

RP-HPLC

-20°C

This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.

Reconstitute in sterile distilled H2O to no less than 100ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.