ANGPTL4;ARP4;HFARP;PGAR;PP1158;PSEC0166;UNQ171/PRO197

Angiopoietin-related protein 4 (Angiopoietin-like protein 4) (Hepatic fibrinogen/angiopoietin-related protein) (HFARP) [Cleaved into: ANGPTL4 N-terminal chain; ANGPTL4 C-terminal chain]

Homo sapiens (Human)

45214

406

N/A

Angiopoietin-related protein 4 (Angiopoietin-like protein 4) (Hepatic fibrinogen/angiopoietin-related protein) (HFARP) [Cleaved into: ANGPTL4 N-terminal chain; ANGPTL4 C-terminal chain]

N/A

MUTAGEN 40 40 E->A: Loss of inactivation of lipoprotein lipase LPL. {ECO:0000269|PubMed:19270337}.; MUTAGEN 40 40 E->D: Decreased inactivation of lipoprotein lipase LPL. {ECO:0000269|PubMed:19270337}.; MUTAGEN 76 76 C->A: No effect on secretion and proteolytic cleavage. Loss of oligomerization; when associated with A-80. {ECO:0000269|PubMed:19270337}.; MUTAGEN 80 80 C->A: No effect on secretion and proteolytic cleavage. Loss of oligomerization; when associated with A-76. {ECO:0000269|PubMed:19270337}.; MUTAGEN 161 164 RRKR->GSGS: Loss of proteolytic cleavage. No effect on the ability to inactivate lipoprotein lipase LPL. {ECO:0000269|PubMed:19270337}.; MUTAGEN 161 161 R->A: Loss of proteolytic cleavage. Decreased ability to inactivate lipoprotein lipase LPL. {ECO:0000269|PubMed:21398697}.; MUTAGEN 164 164 R->A: Loss of proteolytic cleavage. {ECO:0000269|PubMed:21398697}.; MUTAGEN 223 223 G->R: Impaired protein folding. {ECO:0000269|PubMed:29713054}.

MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS

Mediates inactivation of the lipoprotein lipase LPL, and thereby plays a role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism (PubMed:19270337, PubMed:21398697, PubMed:27929370, PubMed:29899144). May also play a role in regulating glucose homeostasis and insulin sensitivity (Probable). Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage (PubMed:14583458, PubMed:17068295). Upon heterologous expression, inhibits the adhesion of endothelial cell to the extracellular matrix (ECM), and inhibits the reorganization of the actin cytoskeleton, formation of actin stress fibers and focal adhesions in endothelial cells that have adhered to ANGPTL4-containing ECM (in vitro) (PubMed:17068295). Depending on context, may modulate tumor-related angiogenesis (By similarity). {ECO:0000250|UniProtKB:Q9Z1P8, ECO:0000269|PubMed:14583458, ECO:0000269|PubMed:17068295, ECO:0000269|PubMed:19270337, ECO:0000269|PubMed:21398697, ECO:0000269|PubMed:27929370, ECO:0000269|PubMed:29899144, ECO:0000305|PubMed:29899519}.; ANGPTL4 N-terminal chain: Mediates inactivation of the lipoprotein lipase LPL, and thereby plays an important role in the regulation of triglyceride clearance from the blood serum and in lipid metabolism (PubMed:19270337, PubMed:21398697, PubMed:27929370, PubMed:29899144). Has higher activity in LPL inactivation than the uncleaved protein (PubMed:19270337, PubMed:21398697). {ECO:0000269|PubMed:19270337, ECO:0000269|PubMed:21398697, ECO:0000269|PubMed:27929370, ECO:0000269|PubMed:29899144}.

Alternative sequence (2); Beta strand (10); Chain (3); Coiled coil (1); Disulfide bond (2); Domain (1); Erroneous initiation (1); Glycosylation (1); Helix (8); Mutagenesis (8); Natural variant (28); Sequence conflict (11); Signal peptide (1); Site (1); Up-regulated when cells are exposed to severe hypoxia (in vitro). {ECO:0000269|PubMed:17068295}.; Detected in blood plasma (at protein level) (PubMed:29899519). Detected in liver (PubMed:10698685). Detected in white fat tissue and placenta (PubMed:10866690). Expressed at high levels in the placenta, heart, liver, muscle, pancreas and lung but expressed poorly in the brain and kidney. {ECO:0000269|PubMed:10698685, ECO:0000269|PubMed:10866690, ECO:0000269|PubMed:12015030, ECO:0000269|PubMed:29899519}.

Angiopoietin-related protein 4 (Angiopoietin-like protein 4) (Hepatic fibrinogen/angiopoietin-related protein) (HFARP) [Cleaved into: ANGPTL4 N-terminal chain; ANGPTL4 C-terminal chain]

Recombinant

HEK293

Lyophilized

7.4-7.5

Sterile-filtered colorless solution

1mg/ml

Standard

PBS

SDS-PAGE

> 98%

RP-HPLC

-20°C

This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.

Reconstitute in sterile distilled H2O to no less than 100ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.