Prolactin
Human Recombinant PRL
Reference ID:KB-2661
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:PRL
Protein Names:Prolactin (PRL)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):258.76
Length (aa):227
Sequence:MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 6
Function [CC]:Prolactin acts primarily on the mammary gland by promoting lactation.
Mutagenesis:MUTAGEN 157 157 G->D,F,L,N,R,V,Y: Inhibits signaling via PRLR; mutant PRL acts as PRLR antagonist. {ECO:0000269|PubMed:17785459}.
Reagent Data
Name:Prolactin
Class:Hormone
Subcategory:Protein
Molecular Weight:23.007
Source:E.Coli
Species:Human
Tag:
Amino Acid Sequence:five N-terminal amino acids is Met-Leu-Pro-Ile-Cys
Format:Lyophilized
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:10 mM
Buffer Solution:Sodium-phosphate
pH:8
Stabilizers
NaCl:50 mM
Purity:> 95%
Determined: SDS-PAGE
Sample Handling
Storage:-18°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.