Myelin Oligodendrocyte Glyco
Human Recombinant MOG - His Tagged
Reference ID:KB-2484
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:MOG
Protein Names:Myelin-oligodendrocyte glycoprotein
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):281.93
Length (aa):247
Sequence:MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 6
Function [CC]:Mediates homophilic cell-cell adhesion (By similarity). Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication. {ECO:0000250}.; (Microbial infection) Acts as a receptor for rubella virus. {ECO:0000269|PubMed:21880773}.
Tissue Specificity:Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.
Disease:Narcolepsy 7 (NRCLP7) [MIM:614250]: Neurological disabling sleep disorder, characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, cataplexy, hypnagogic hallucinations, and sleep paralysis. Cataplexy is a sudden loss of muscle tone triggered by emotions, which is the most valuable clinical feature used to diagnose narcolepsy. Human narcolepsy is primarily a sporadically occurring disorder but familial clustering has been observed. {ECO:0000269|PubMed:21907016}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Reagent Data
Name:Myelin Oligodendrocyte Glyco
Class:Adhesion Molecule
Subcategory:Protein
Molecular Weight:15.2
Source:E.Coli
Species:Human
Tag:His
Amino Acid Sequence:Met-GQFRVIGPRHPIRALVGDEVE LPCRISPGKNATGMEVGWYR PPFSRVVHLYRNGKDQDGDQ APEYRGRTELLKDAIGEGKV TLRIRNVRFSDEGGFTCFFR DHSYQEEAAM ELKVEDPFYWVSPGHHHHHH
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:20 mM
Buffer Solution:Sodium-acetate
pH:4
Stabilizers
Sodium-chloride:0.3 M
Purity:> 95%
Determined: SDS-PAGE
Sample Handling
Storage:4°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.