Mn Superoxide Dismutase
Human Recombinant SOD2 - His Tagged
Reference ID:KB-2446
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:SOD2
Protein Names:Superoxide dismutase [Mn], mitochondrial (EC 1.15.1.1)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):247.50
Length (aa):222
Sequence:MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 6
Catalytic Activity: Reaction=2 H(+) + 2 superoxide = H2O2 + O2; Xref=Rhea:RHEA:20696, ChEBI:CHEBI:15378, ChEBI:CHEBI:15379, ChEBI:CHEBI:16240, ChEBI:CHEBI:18421; EC=1.15.1.1;
Cofactor:Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Note=Binds 1 Mn(2+) ion per subunit.;
Function [CC]:Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems. {ECO:0000269|PubMed:10334867}.
Metal Binding:METAL 50 50 Manganese.; METAL 98 98 Manganese.; METAL 183 183 Manganese.; METAL 187 187 Manganese.
Induction:Expression is regulated by KRIT1. {ECO:0000269|PubMed:20668652}.
Chemical Profile | ChEBI:H2O2 [CHEBI:16240]; H(+) [CHEBI:15378]; O2 [CHEBI:15379]; superoxide [CHEBI:18421]; Mn(2+) [CHEBI:29035]
ChEBI (Catalytic Activity):H2O2 [CHEBI:16240]; H(+) [CHEBI:15378]; O2 [CHEBI:15379]; superoxide [CHEBI:18421]
ChEBI (Cofactor):Mn(2+) [CHEBI:29035]
Disease:Microvascular complications of diabetes 6 (MVCD6) [MIM:612634]: Pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. {ECO:0000269|PubMed:12624725, ECO:0000269|PubMed:18989629}. Note=Disease susceptibility is associated with variations affecting the gene represented in this entry.
Mutagenesis:MUTAGEN 58 58 Y->A,H,N,V,F: Reduced enzyme activity. {ECO:0000269|PubMed:10334867}.; MUTAGEN 58 58 Y->F: Loss of nitration. Enhanced dityrosine formation on peroxynitrite treatment. {ECO:0000269|PubMed:10334867}.
Reagent Data
Name:Mn Superoxide Dismutase
Class:Superoxide Dismutase
Subcategory:Enzyme
Region:25 - 222
Molecular Weight:24.4
Source:E.Coli
Species:Human
Tag:His
Amino Acid Sequence:MGSSHHHHHH SSGLVPRGSH MKHSLPDLPY DYGALEPHIN AQIMQLHHSK HHAAYVNNLN VTEEKYQEAL AKGDVTAQIA LQPALKFNGG GHINHSIFWT NLSPNGGGEP KGELLEAIKR DFGSFDKFKE KLTAASVGVQ GSGWGWLGFN KERGHLQIAA CPNQDPLQGT TGLIPLLGID VWEHAYYLQY KNVRPDYLKA IWNVINWENV TERYMACKK
Format:Solution
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:20 mM
Buffer Solution: Tris-HCl
pH:8
Stabilizers
Glycerol:0.2
Purity:> 95%
Determined: SDS-PAGE
Sample Handling
Storage:4°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.