Macrophage Inflammatory -1alpha
Human Recombinant CCL3
Reference ID:KB-2420
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:CCL3;G0S19-1;MIP1A;SCYA3
Protein Names:C-C motif chemokine 3 (G0/G1 switch regulatory protein 19-1) (Macrophage inflammatory protein 1-alpha) (MIP-1-alpha) (PAT 464.1) (SIS-beta) (Small-inducible cytokine A3) (Tonsillar lymphocyte LD78 alpha protein) [Cleaved into: MIP-1-alpha(4-69) (LD78-alpha(4-69))]
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):100.85
Length (aa):92
Sequence:MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 17
Function [CC]:Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). {ECO:0000269|PubMed:8525373}.
Site:SITE 40 40 Involved in GAG binding.; SITE 68 68 Involved in GAG binding.; SITE 70 70 Involved in GAG binding.
Induction:By TPA or PHA (TPA = 12-O-tetradecanoyl phorbol-13 acetate (tumor promoter); PHA = phytohemagglutinin (T-cell mitogen)).
Mutagenesis:MUTAGEN 40 40 R->A: Slightly reduces heparin binding. {ECO:0000269|PubMed:9092555}.; MUTAGEN 49 49 D->A: Reduces self-association; in BB-10010: Improved pharmaceutical properties. {ECO:0000269|PubMed:10347159, ECO:0000269|PubMed:8541527}.; MUTAGEN 68 68 R->A: Strongly reduces heparin binding. {ECO:0000269|PubMed:9092555}.; MUTAGEN 70 70 R->A: Reduces heparin binding. {ECO:0000269|PubMed:9092555}.; MUTAGEN 89 89 E->A: Reduces self-association. {ECO:0000269|PubMed:10347159}.
Reagent Data
Name:Macrophage Inflammatory -1alpha
Class:Chemokine
Subcategory:Protein
Molecular Weight:7.82
Source:E.Coli
Species:Human
Tag:
Extinction:0.9
Format:Lyophilized
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Silver
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:4°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.