Keinocyte Growth Factor
Human Recombinant FGF7
Reference ID:KB-2351
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:FGF7;KGF
Protein Names:Fibroblast growth factor 7 (FGF-7) (Heparin-binding growth factor 7) (HBGF-7) (Keratinocyte growth factor)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):225.09
Length (aa):194
Sequence:MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 15
Function [CC]:Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation. {ECO:0000269|PubMed:16597617, ECO:0000269|PubMed:8663044}.
Tissue Specificity:Epithelial cell.
Reagent Data
Name:Keinocyte Growth Factor
Class:Growth Factor
Subcategory:Protein
Molecular Weight:18.995
Source:E.Coli
Species:Human
Tag:
Extinction:0.9
Format:Lyophilized
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 97%
Determined: SDS-PAGE
Stain:Silver
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:4°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.