Keinocyte Growth Factor
Rat Recombinant FGF7
Reference ID:KB-2350
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:FGF7;KGF
Protein Names:Fibroblast growth factor 7 (FGF-7) (Heparin-binding growth factor 7) (HBGF-7) (Keratinocyte growth factor)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):225.09
Length (aa):194
Sequence:MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 15
Function [CC]:Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation. {ECO:0000269|PubMed:16597617, ECO:0000269|PubMed:8663044}.
Tissue Specificity:Epithelial cell.
Reagent Data
Name:Keinocyte Growth Factor
Class:Growth Factor
Subcategory:Protein
Molecular Weight:17
Source:E.Coli
Species:Rat
Specificity:Binds to keratinocytes and most parenchymal epithelial cells; binds specific splice variant of FGF receptor expessed in epithelial cells (FGFr2IIIb)
Tag:
Bioactivity
Measured:? 5 IU/mg
Determined By:Assay (Variable)
Assay Profile:substrate: heparan sulfate
Features:Genetically engineered E. coli
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Purity:> 90%
Determined: SDS-PAGE
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.