Hsp20
Human Recombinant HSP20
Reference ID:KB-2227
Western Blot
Gene of Interest
Gene Synonyms:HSP20
Protein Names:Heat shock protein homolog (HSP20)
Accession Data
Organism:Nippostrongylus brasiliensis (Rat hookworm)
Mass (kDa):202.27
Length (aa):172
Sequence:MALWPVDRFERMMMEDPMRAMDRFGRMGDMDHWMSRRMMPYWRDADHSMLHVGNQKEVINDDKKFAVSLDVKHFKPNELKVQLDDRDLTVEGMQEVKTEHGYIKKQFVHRWSLPEDCDLDAVHTELDNHGHLSIEAPEDGPSQKFQSSAHSSSAEEEEVGDIEPVNKRILYK
Proteomics (Proteome ID):UP000038043
Proteomics (Chromosome): Genome assembly
Reagent Data
Name:Hsp20
Class:Heat Shock
Subcategory:Protein
Source:E.Coli
Species:Human
Tag:
Format:Lyophilized
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:20 mM
Buffer Solution: Tris-acetate
pH:7.6
Stabilizers
NaCl:10 mM
PMSF:0.1 mM
Reducing Agents
β-mercaptoethanol:15 mM
Metal Chelating Agents
EDTA:0.1 mM
Purity:> 95%
Determined: SDS-PAGE
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.