DnaJ
Human Recombinant DNAJB1 - His Tagged
Reference ID:KB-1892
Western Blot
Gene of Interest
Gene Synonyms:DNAJB1;DNAJ1;HDJ1;HSPF1
Protein Names:DnaJ homolog subfamily B member 1 (DnaJ protein homolog 1) (Heat shock 40 kDa protein 1) (HSP40) (Heat shock protein 40) (Human DnaJ protein 1) (hDj-1)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):380.44
Length (aa):340
Sequence:MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 19
Function [CC]:Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP. Negatively regulates heat shock-induced HSF1 transcriptional activity during the attenuation and recovery phase period of the heat shock response (PubMed:9499401). Stimulates ATP hydrolysis and the folding of unfolded proteins mediated by HSPA1A/B (in vitro) (PubMed:24318877). {ECO:0000269|PubMed:24318877, ECO:0000269|PubMed:9499401}.
Induction:By heat shock. {ECO:0000269|PubMed:1586970}.
Reagent Data
Name:DnaJ
Class:Heat Shock
Subcategory:Protein
Molecular Weight:40.2
Source:E.Coli
Species:Human
Tag:His
Amino Acid Sequence:MGSSHHHHHH SSGLVPRGSH MGKDYYQTLG LARGASDEEI KRAYRRQALR YHPDKNKEPG AEEKFKEIAE AYDVLSDPRK REIFDRYGEE GLKGSGPSGG SGGGANGTSF SYTFHGDPHAMFAEFFGGRN PFDTFFGQRN GEEGMDIDDP FSGFPMGMGG FTNVNFGRSR SAQEPARKKQ DPPVTHDLRV SLEEIYSGCT KKMKISHKRL NPDGKSIRNE DKILTIEVKK GWKEGTKITF PKEGDQTSNN IPADIVFVLK DKPHNIFKRD GSDVIYPARI SLREALCGCT VNVPTLDGRT IPVVFKDVIR PGMRRKVPGE GLPLPKTPEK RGDLIIEFEV IFPERIPQTS RTVLEQVLPI
Bioactivity
Measured:10^5 Units/mg
Determined By:Assay (Variable)
Assay Profile:LOT-Specific (Check COA)
Format:Solution
Purification System:Chromatography
Buffer Volume:20 mM
Buffer Solution:Tris
pH:8
Reducing Agents
DTT:2 mM
Purity:> 95%
Determined: SDS-PAGE
Sample Handling
Storage:4°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.