CXCL8
Human Recombinant CXCL8
Reference ID:KB-1827
Western Blot
Gene of Interest
Gene Synonyms:CXCL8;IL8
Protein Names:Interleukin-8 (IL-8) (C-X-C motif chemokine 8) (Chemokine (C-X-C motif) ligand 8) (Emoctakin) (Granulocyte chemotactic protein 1) (GCP-1) (Monocyte-derived neutrophil chemotactic factor) (MDNCF) (Monocyte-derived neutrophil-activating peptide) (MONAP) (Neutrophil-activating protein 1) (NAP-1) (Protein 3-10C) (T-cell chemotactic factor) [Cleaved into: MDNCF-a (GCP/IL-8 protein IV) (IL8/NAP1 form I); Interleukin-8 ((Ala-IL-8)77) (GCP/IL-8 protein II) (IL-8(1-77)) (IL8/NAP1 form II) (MDNCF-b); IL-8(5-77); IL-8(6-77) ((Ser-IL-8)72) (GCP/IL-8 protein I) (IL8/NAP1 form III) (Lymphocyte-derived neutrophil-activating factor) (LYNAP) (MDNCF-c) (Neutrophil-activating factor) (NAF); IL-8(7-77) (GCP/IL-8 protein V) (IL8/NAP1 form IV); IL-8(8-77) (GCP/IL-8 protein VI) (IL8/NAP1 form V); IL-8(9-77) (GCP/IL-8 protein III) (IL8/NAP1 form VI)]
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):110.98
Length (aa):99
Sequence:MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 4
Function [CC]:IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. {ECO:0000269|PubMed:11978786, ECO:0000269|PubMed:2145175, ECO:0000269|PubMed:2212672}.
Site:SITE 27 28 Cleavage; by thrombin. {ECO:0000305}.; SITE 28 29 Cleavage; by MMP9.
Induction:By ER stress in a DDIT3/CHOP-dependent manner. {ECO:0000269|PubMed:20829347}.
Reagent Data
Name:CXCL8
Class:Chemokine
Subcategory:Protein
Region:28 - 99
Molecular Weight:8.386
Source:E.Coli
Species:Human
Tag:
Amino Acid Sequence:SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGR ELCLDPKENWVQRVVEKFLKRAENS
Bioactivity
Measured:2,000,000 IU/mg
Determined By:Migration Assay
Assay Profile: recombinant CXCR1-expressing cells
EC50=0.083 nM
Format:Lyophilized
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Screened:< 0.01 EU per 1ug of protein by LAL method
Purity:> 97%
Determined: SDS-PAGE
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.