CCL5, biotinylated
Human Recombinant CCL5 - Biotin Tagged
Reference ID:KB-1823
Western Blot
Gene of Interest
Gene Synonyms:CCL5;D17S136E;SCYA5
Protein Names:C-C motif chemokine 5 (EoCP) (Eosinophil chemotactic cytokine) (SIS-delta) (Small-inducible cytokine A5) (T cell-specific protein P228) (TCP228) (T-cell-specific protein RANTES) [Cleaved into: RANTES(3-68); RANTES(4-68)]
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):99.90
Length (aa):91
Sequence:MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 17
Mass Spectrometry: Mass=7515; Mass_error=1; Method=SELDI; Range=27-91; Evidence={ECO:0000269|PubMed:15923218}; Mass=7862.8; Mass_error=1.1; Method=Electrospray; Range=24-91; Evidence={ECO:0000269|PubMed:1380064}; Mass=8355; Mass_error=10; Method=Electrospray; Range=24-91; Note=O-glycosylated.; Evidence={ECO:0000269|PubMed:1380064};
Function [CC]:Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils (PubMed:16791620, PubMed:1380064, PubMed:8525373, PubMed:9516414, PubMed:15923218). May also be an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization through its activation. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells (PubMed:23979485). {ECO:0000269|PubMed:1380064, ECO:0000269|PubMed:15923218, ECO:0000269|PubMed:16791620, ECO:0000269|PubMed:17001303, ECO:0000269|PubMed:23979485, ECO:0000269|PubMed:8525373, ECO:0000269|PubMed:9516414}.
Site:SITE 25 26 Cleavage; by DPP4.
Induction:By mitogens.
Tissue Specificity:Expressed in the follicular fluid (at protein level). T-cell and macrophage specific. {ECO:0000269|PubMed:23765988, ECO:0000269|PubMed:2456327}.
Reagent Data
Name:CCL5, biotinylated
Class:Chemokine
Subcategory:Protein
Region:24 - 91
Source:E.Coli
Species:Human
Tag:Biotin
Amino Acid Sequence:SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQV CANPEKKWVREYINSLEMS
Bioactivity
Measured:1 x 10^6 IU/mg
Determined By:Migration Assay
Assay Profile: cells expressing recombinant CCR5
EC50=0.25-0.50 nM
Format:Lyophilized
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Screened:< 0.01 EU per 1ug of protein by LAL method
Purity:> 97%
Determined: SDS-PAGE
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.