CXCL10
Human Recombinant CXCL10
Reference ID:KB-1813
Western Blot
Gene of Interest
Gene Synonyms:CXCL10;INP10;SCYB10
Protein Names:C-X-C motif chemokine 10 (10 kDa interferon gamma-induced protein) (Gamma-IP10) (IP-10) (Small-inducible cytokine B10) [Cleaved into: CXCL10(1-73)]
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):108.81
Length (aa):98
Sequence:MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 4
Mass Spectrometry: Mass=8641.8; Method=Electrospray; Range=22-98; Evidence={ECO:0000269|PubMed:11559369};
Function [CC]:Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects (PubMed:7540647, PubMed:11157474, PubMed:22652417). Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites (By similarity). Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization (PubMed:12750173, PubMed:19151743). In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation (PubMed:12750173, PubMed:12663757). Activation of the CXCL10/CXCR3 axis plays also an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization (By similarity). {ECO:0000250|UniProtKB:P17515, ECO:0000269|PubMed:11157474, ECO:0000269|PubMed:12663757, ECO:0000269|PubMed:12750173, ECO:0000269|PubMed:19151743, ECO:0000269|PubMed:22652417, ECO:0000269|PubMed:7540647}.
Induction:By IFNG/IFN-gamma. A diverse population of cell types rapidly increases transcription of mRNA encoding this protein. This suggests that gamma-induced protein may be a key mediator of the IFNG/IFN-gamma response.
Tissue Specificity:Mainly secreted by monocytes, endothelial cells as well as fibroblasts. Expressed by epithelial cells in thymus (PubMed:11157474). Microglial cells produce CXCL10 in response to viral stimulation (PubMed:12663757). {ECO:0000269|PubMed:11157474, ECO:0000269|PubMed:12663757}.
Reagent Data
Name:CXCL10
Class:Chemokine
Subcategory:Protein
Region:22 - 98
Molecular Weight:8.646
Source:E.Coli
Species:Human
Tag:
Amino Acid Sequence:VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGE KRCLNPESKAIKNLLKAVSKERSKRSP
Bioactivity
Determined By:Migration Assay
Assay Profile: cells expressing recombinant CXCR3
EC50=6.3 nM
Format:Lyophilized
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Screened:< 0.01 EU per 1ug of protein by LAL method
Purity:> 97%
Determined: SDS-PAGE
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.