CCL7
Human Recombinant CCL7
Reference ID:KB-1692
Western Blot
Gene of Interest
Gene Synonyms:CCL7;MCP3;SCYA6;SCYA7
Protein Names:C-C motif chemokine 7 (Monocyte chemoattractant protein 3) (Monocyte chemotactic protein 3) (MCP-3) (NC28) (Small-inducible cytokine A7)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):112.00
Length (aa):99
Sequence:MKASAALLCLLLTAAAFSPQGLAQPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFKTKLDKEICADPTQKWVQDFMKHLDKKTQTPKL
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 17
Function [CC]:Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3.
Reagent Data
Name:CCL7
Class:Chemokine
Subcategory:Protein
Molecular Weight:8.956
Source:E.Coli
Species:Human
Tag:
Amino Acid Sequence:QPVGINTSTTCCYRFINKKIPKQRLESYRRTTSSHCPREAVIFK TKLDKEICADPTQKWVQDFMKHLDKKTQTPKL
Bioactivity
Determined By:Migration Assay
Assay Profile: recombinant CCR2-expressing cells
EC50=0.91 nM
Format:Lyophilized
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Screened:< 0.01 EU per 1ug of protein by LAL method
Purity:> 97%
Determined: SDS-PAGE
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.