CCL4, biotinylated
Human Recombinant CCL4 - Biotin Tagged
Reference ID:KB-1679
Western Blot
Gene of Interest
Gene Synonyms:CCL4;LAG1;MIP1B;SCYA4
Protein Names:C-C motif chemokine 4 (G-26 T-lymphocyte-secreted protein) (HC21) (Lymphocyte activation gene 1 protein) (LAG-1) (MIP-1-beta(1-69)) (Macrophage inflammatory protein 1-beta) (MIP-1-beta) (PAT 744) (Protein H400) (SIS-gamma) (Small-inducible cytokine A4) (T-cell activation protein 2) (ACT-2) [Cleaved into: MIP-1-beta(3-69)]
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):102.12
Length (aa):92
Sequence:MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 17
Function [CC]:Monokine with inflammatory and chemokinetic properties. Binds to CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-beta induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form MIP-1-beta(3-69) retains the abilities to induce down-modulation of surface expression of the chemokine receptor CCR5 and to inhibit the CCR5-mediated entry of HIV-1 in T-cells. MIP-1-beta(3-69) is also a ligand for CCR1 and CCR2 isoform B. {ECO:0000269|PubMed:10540332, ECO:0000269|PubMed:12070155, ECO:0000269|PubMed:8525373}.
Induction:By mitogens.
Reagent Data
Name:CCL4, biotinylated
Class:Chemokine
Subcategory:Protein
Region:24 - 92
Molecular Weight:10.237
Source:E.Coli
Species:Human
Tag:Biotin
Amino Acid Sequence:APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTK RSKQVCADPSESWVQEYVYDLELN
Bioactivity
Determined By:Migration Assay
Assay Profile: cells expressing recombinant CCR5
EC50=0.32-1.3 nM
Format:Lyophilized
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Screened:< 0.01 EU per 1ug of protein by LAL method
Purity:> 97%
Determined: SDS-PAGE
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.