CCL28, biotinylated
Human Recombinant CCL28 - Biotin Tagged
Reference ID:KB-1662
Western Blot
Gene of Interest
Gene Synonyms:CCL28;SCYA28
Protein Names:C-C motif chemokine 28 (Mucosae-associated epithelial chemokine) (MEC) (Protein CCK1) (Small-inducible cytokine A28)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):142.80
Length (aa):127
Sequence:MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 5
Function [CC]:Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner.
Tissue Specificity:Preferentially expressed by epithelial cells of diverse tissues including normal and pathological colon, salivary gland, mammary gland, trachea and rectum. Also found in prostate, spleen, thyroid, psoriasis skin and in lower levels in peripheral blood leukocytes, small intestine, Peyer patches, stomach and normal skin.
Reagent Data
Name:CCL28, biotinylated
Class:Chemokine
Subcategory:Protein
Region:23 - 127
Molecular Weight:14.3
Source:E.Coli
Species:Human
Tag:Biotin
Amino Acid Sequence:ILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRR ICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQG KHETYGHKTPY
Bioactivity
Measured:11,100,000 IU/mg
Determined By:Migration Assay
Assay Profile: recombinant cells expressing CCR10
EC50=40-60 nM
Format:Lyophilized
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Screened:< 0.01 EU per 1ug of protein by LAL method
Purity:> 97%
Determined: SDS-PAGE
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.