CCL27
Human Recombinant CCL27
Reference ID:KB-1654
Western Blot
ELISA
Gene of Interest
Gene Synonyms:CCL27;ILC;SCYA27
Protein Names:C-C motif chemokine 27 (CC chemokine ILC) (Cutaneous T-cell-attracting chemokine) (CTACK) (ESkine) (IL-11 R-alpha-locus chemokine) (Skinkine) (Small-inducible cytokine A27)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):126.18
Length (aa):112
Sequence:MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 9
Function [CC]:Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. Binds to CCR10.
Tissue Specificity:Testis, thymus, placenta, ovary and skin.
Reagent Data
Name:CCL27
Class:Chemokine
Subcategory:Protein
Region:25 - 112
Molecular Weight:10.149
Source:E.Coli
Species:Human
Tag:
Amino Acid Sequence:FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQ RSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Bioactivity
Measured:1-10 ng/ml
Determined By:Migration Assay
Assay Profile: L1.2 cells expressing CCR10
EC50=34 nM
Format:Lyophilized
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Screened:< 0.01 EU per 1ug of protein by LAL method
Purity:> 97%
Determined: SDS-PAGE
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.