CCL19
Human Recombinant CCL19
Reference ID:KB-1634
Western Blot
Gene of Interest
Gene Synonyms:CCL19;ELC;MIP3B;SCYA19
Protein Names:C-C motif chemokine 19 (Beta-chemokine exodus-3) (CK beta-11) (Epstein-Barr virus-induced molecule 1 ligand chemokine) (EBI1 ligand chemokine) (ELC) (Macrophage inflammatory protein 3 beta) (MIP-3-beta) (Small-inducible cytokine A19)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):109.93
Length (aa):98
Sequence:MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 9
Function [CC]:May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4. {ECO:0000269|PubMed:9498785}.
Tissue Specificity:Expressed at high levels in the lymph nodes, thymus and appendix. Intermediate levels seen in colon and trachea, while low levels found in spleen, small intestine, lung, kidney and stomach.
Reagent Data
Name:CCL19
Class:Chemokine
Subcategory:Protein
Molecular Weight:8.8
Source:E.Coli
Species:Human
Tag:
Amino Acid Sequence:GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLC APPDQPWVERIIQRLQRTSAKMKRRSS
Bioactivity
Measured:One unit will inhibit the rate of reduction of cytochrome c by 50% in a coupled system using xanthine and xanthine oxidase at pH 7.8 at 25°C in a 1.5ml reaction volume.
Determined By:Calcium Flux Assay
Assay Profile: recombinant human CCR7
EC50=30 nM
Format:Lyophilized
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Screened:< 0.01 EU per 1ug of protein by LAL method
Purity:> 97%
Determined: SDS-PAGE
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.