CCL14
Human Recombinant CCL14
Reference ID:KB-1624
Western Blot
Gene of Interest
Gene Synonyms:CCL14;NCC2;SCYA14
Protein Names:C-C motif chemokine 14 (Chemokine CC-1/CC-3) (HCC-1/HCC-3) (HCC-1(1-74)) (NCC-2) (Small-inducible cytokine A14) [Cleaved into: HCC-1(3-74); HCC-1(4-74); HCC-1(9-74)]
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):106.78
Length (aa):93
Sequence:MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 17
Function [CC]:Has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha. It induces intracellular Ca(2+) changes and enzyme release, but no chemotaxis, at concentrations of 100-1,000 nM, and is inactive on T-lymphocytes, neutrophils, and eosinophil leukocytes. Enhances the proliferation of CD34 myeloid progenitor cells. The processed form HCC-1(9-74) is a chemotactic factor that attracts monocytes, eosinophils, and T-cells and is a ligand for CCR1, CCR3 and CCR5. {ECO:0000269|PubMed:11085751}.
Tissue Specificity:Expressed constitutively in several normal tissues: spleen, liver, skeletal and heart muscle, gut, and bone marrow, present at high concentrations (1-80 nM) in plasma. {ECO:0000269|PubMed:9600961}.
Reagent Data
Name:CCL14
Class:Chemokine
Subcategory:Protein
Region:28 - 93
Molecular Weight:7.801
Source:E.Coli
Species:Human
Tag:
Amino Acid Sequence:GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVC TNPSDKWVQDYIKDMKEN
Bioactivity
Determined By:Migration Assay
Assay Profile: cells expressing CCR1
EC50=0.1-0.4 nM
Format:Lyophilized
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Screened:< 0.01 EU per 1ug of protein by LAL method
Purity:> 97%
Determined: SDS-PAGE
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.