Cardiac Troponin C
Human Recombinant TNNC1
Reference ID:KB-1591
Western Blot
Gene of Interest
Gene Synonyms:TNNC1;TNNC
Protein Names:Troponin C, slow skeletal and cardiac muscles (TN-C)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):184.03
Length (aa):161
Sequence:MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 3
Calcium Binding:CA_BIND 65 76 1.; CA_BIND 105 116 2.; CA_BIND 141 152 3.
Function [CC]:Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments.
Disease:Cardiomyopathy, dilated 1Z (CMD1Z) [MIM:611879]: A disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. {ECO:0000269|PubMed:15542288}. Note=The disease is caused by mutations affecting the gene represented in this entry.; Cardiomyopathy, familial hypertrophic 13 (CMH13) [MIM:613243]: A hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death. {ECO:0000269|PubMed:11385718, ECO:0000269|PubMed:16302972, ECO:0000269|PubMed:18572189, ECO:0000269|PubMed:19439414}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Miscellaneous [CC]:Cardiac muscle Tn-C can bind 3 calcium ions per molecule. Domain I does not bind calcium.
Reagent Data
Name:Cardiac Troponin C
Class:Hormone
Subcategory:Protein
Molecular Weight:18
Source:E.Coli
Species:Human
Tag:
Format:Solution
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:10 mM
Buffer Solution:Sodium-phosphate
pH:7
Stabilizers
NaCl:150 mM
Preservatives
Sodium Azide:0.0005
Purity:> 95%
Determined: SDS-PAGE
Sample Handling
Storage:4°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.