Alpha Crystallin B
Mouse Recombinant Cryab
Reference ID:KB-1405
Western Blot
Gene of Interest
Gene Synonyms:Cryab;Crya2
Protein Names:Alpha-crystallin B chain (Alpha(B)-crystallin) (P23)
Accession Data
Organism:Mus musculus (Mouse)
Mass (kDa):200.69
Length (aa):175
Sequence:MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSWIDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVAAAPKK
Proteomics (Proteome ID):UP000000589
Proteomics (Chromosome): Chromosome 9
Function [CC]:May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions.
Metal Binding:METAL 83 83 Zinc 1. {ECO:0000250}.; METAL 104 104 Zinc 2. {ECO:0000250}.; METAL 106 106 Zinc 2. {ECO:0000250}.; METAL 111 111 Zinc 1. {ECO:0000250}.; METAL 119 119 Zinc 1. {ECO:0000250}.
Tissue Specificity:Lens as well as other tissues.
Reagent Data
Name:Alpha Crystallin B
Class:Heat Shock
Subcategory:Protein
Molecular Weight:20
Source:E.Coli
Species:Mouse
Tag:
Amino Acid Sequence:MDIAIHHPWI RRPFFPFHSP SRLFDQFFGE HLLESDLFST ATSLSPFYLR PPSFLRAPSW IDTGLSEMRL EKDRFSVNLD VKHFSPEELK VKVLGDVIEV HGKHEERQDE HGFISREFHR KYRIPADVDP LTITSSLSSD GVLTVNGPRK QVSGPERTIP ITREEKPAVA AAPKK
Format:Solution
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:20 mM
Buffer Solution: Tris
pH:8
Stabilizers
Glycerol:0.1
Purity:> 95%
Determined: SDS-PAGE
Stain:Silver
Validated: RP-HPLC
Sample Handling
Storage:4°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.