Alpha Crystallin A
Human Recombinant CRYAA
Reference ID:KB-1399
Western Blot
Gene of Interest
Gene Synonyms:CRYAA;CRYA1;HSPB4
Protein Names:Alpha-crystallin A chain (Heat shock protein beta-4) (HspB4) [Cleaved into: Alpha-crystallin A(1-172); Alpha-crystallin A(1-168); Alpha-crystallin A(1-162)]
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):199.09
Length (aa):173
Sequence:MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 21
Mass Spectrometry: Mass=19950; Method=Electrospray; Range=1-173; Evidence={ECO:0000269|PubMed:8175657}; Mass=19863; Method=Electrospray; Range=1-172; Evidence={ECO:0000269|PubMed:8175657}; Mass=20029; Method=Electrospray; Range=1-173; Note=With 1 phosphate group.; Evidence={ECO:0000269|PubMed:8175657}; Mass=19951; Method=Electrospray; Range=1-173; Evidence={ECO:0000269|PubMed:9655350}; Mass=19864; Method=Electrospray; Range=1-172; Evidence={ECO:0000269|PubMed:9655350}; Mass=19947; Method=Electrospray; Range=1-173; Evidence={ECO:0000269|PubMed:10930324}; Mass=19851; Method=Electrospray; Range=1-172; Evidence={ECO:0000269|PubMed:10930324};
Function [CC]:Contributes to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions. {ECO:0000269|PubMed:22120592}.
Metal Binding:METAL 79 79 Zinc 1. {ECO:0000305}.; METAL 100 100 Zinc 2. {ECO:0000250}.; METAL 102 102 Zinc 2. {ECO:0000250}.; METAL 107 107 Zinc 1. {ECO:0000305}.; METAL 115 115 Zinc 1. {ECO:0000305}.
Site:SITE 1 1 Susceptible to oxidation.; SITE 18 18 Susceptible to oxidation.; SITE 34 34 Susceptible to oxidation.; SITE 138 138 Susceptible to oxidation.
Tissue Specificity:Expressed in eye lens. {ECO:0000269|PubMed:12356833}.
Disease:Note=Alpha-crystallin A 1-172 is found at nearly twofold higher levels in diabetic lenses than in age-matched control lenses. {ECO:0000269|PubMed:12356833}.; Cataract 9, multiple types (CTRCT9) [MIM:604219]: An opacification of the crystalline lens of the eye that frequently results in visual impairment or blindness. Opacities vary in morphology, are often confined to a portion of the lens, and may be static or progressive. In general, the more posteriorly located and dense an opacity, the greater the impact on visual function. CTRCT9 includes nuclear, zonular central nuclear, anterior polar, cortical, embryonal, anterior subcapsular, fan-shaped, and total cataracts, among others. In some cases cataract is associated with microcornea without any other systemic anomaly or dysmorphism. Microcornea is defined by a corneal diameter inferior to 10 mm in both meridians in an otherwise normal eye. {ECO:0000269|PubMed:11123904, ECO:0000269|PubMed:14512969, ECO:0000269|PubMed:16453125, ECO:0000269|PubMed:18302245, ECO:0000269|PubMed:18407550, ECO:0000269|PubMed:23508780, ECO:0000269|PubMed:9467006}. Note=The disease is caused by mutations affecting the gene represented in this entry.
Mutagenesis:MUTAGEN 123 123 N->D: Impairs chaperone activity. {ECO:0000269|PubMed:18754677}.
Reagent Data
Name:Alpha Crystallin A
Class:Heat Shock
Subcategory:Protein
Molecular Weight:19.9
Source:E.Coli
Species:Human
Tag:
Amino Acid Sequence:MDVTIQHPWF KRTLGPFYPS RLFDQFFGEG LFEYDLLPFL SSTISPYYRQ SLFRTVLDSGISEVRSDRDK FVIFLDVKHF SPEDLTVKVQ DDFVEIHGKH NERQDDHGYI SREFHRRYRLPSNVDQSALS CSLSADGMLT FCGPKIQTGL DATHAERAIP VSREEKPTSA PSS
Format:Solution
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:20 mM
Buffer Solution: Tris-HCl
pH:7.5
Stabilizers
NaCl:50 mM
Metal Chelating Agents
EDTA:1 mM
Purity:> 95%
Determined: SDS-PAGE
Stain:Silver
Validated: RP-HPLC
Sample Handling
Storage:4°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.