Fc gamma RIIIB / CD16b
Human Recombinant FCGR3B - His Tagged
Reference ID:KB-3656
Western Blot
ELISA
FACS
Protein:Protein
Flow Cytometry
Gene of Interest
Gene Synonyms:FCGR3B;CD16B;FCG3;FCGR3;IGFR3
Protein Names:Low affinity immunoglobulin gamma Fc region receptor III-B (Fc-gamma RIII-beta) (Fc-gamma RIII) (Fc-gamma RIIIb) (FcRIII) (FcRIIIb) (FcR-10) (IgG Fc receptor III-1) (CD antigen CD16b)
Accession Data
Organism:Homo sapiens (Human)
Mass (kDa):262.16
Length (aa):233
Sequence:MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
Proteomics (Proteome ID):UP000005640
Proteomics (Chromosome): Chromosome 1
Polymorphism: There are three allelic forms of FCGR3B: FCGR3B*01 (NA-1), FCGR3B*02 (HNA-1b, NA-2) (shown here) and SH. FCGR3B*01 and FCGR3B*02 are detectable with antibodies against the biallelic neutrophil-specific antigen system NA. The more active FCGR3B*01 allele has been associated with severe renal disease in certain systemic vasculitides. {ECO:0000269|PubMed:15245367, ECO:0000269|PubMed:2521732, ECO:0000269|PubMed:2526846, ECO:0000269|PubMed:2967436, ECO:0000269|PubMed:7836402, ECO:0000269|PubMed:9028335}.
Function [CC]:Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Tissue Specificity:Expressed specifically by polymorphonuclear leukocytes (neutrophils). Also expressed by stimulated eosinophils.
Miscellaneous [CC]:Encoded by one of two nearly indentical genes: FCGR3A and FCGR3B (Shown here) which are expressed in a tissue-specific manner. The 'Phe-203' in FCGR3A determines the transmembrane domains whereas the Ser-203 in FCGR3B determines the GPI-anchoring.
Reagent Data
Name:Fc gamma RIIIB / CD16b
Class:Fc Receptor
Subcategory:Protein
Region:Gly 17 - Ser 200
Molecular Weight:22.8
Source:HEK293
Species:Human
Tag:His
Format:Lyophilized
Purification System:Chromatography
Formulation:Sterile-filtered colorless solution
Formulation Concentration:1 mg/ml
Buffer Volume:Standard
Buffer Solution:PBS
pH:7.4-7.5
Toxicity
Endotoxin Level:< 1%
Aggregate Tested By:SDS-PAGE
Endotoxin Screened:< 0.1 ng/ug
Purity:> 98%
Determined: SDS-PAGE
Stain:Blue
Chromotography:Anion-exchange
Validated: RP-HPLC
Sample Handling
Storage:-20°C
Stability:This bioreagent is stable at 4°C (short-term) and -70°C(long-term). After reconstitution, sample may be stored at 4°C for 2-7 days and below -18°C for future use.
Preparation:Reconstitute in sterile distilled H2O to no less than 100 ug/ml; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.